NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003863

3300003863: Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_30_13L



Overview

Basic Information
IMG/M Taxon OID3300003863 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0111355 | Gp0109403 | Ga0062507
Sample NameDiffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS904_30_13L
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size2829880
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDiffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Aphotic Zone → Background Seawater → Diffuse Hydrothermal Flow Volcanic Vent Microbial Communities From Axial Seamount, Northeast Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine hydrothermal vent biomemarine hydrothermal venthydrothermal fluid
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationMarker 33 diffuse flow vent, Axial Seamount
CoordinatesLat. (o)45.9332Long. (o)-129.982268Alt. (m)N/ADepth (m)1516
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F025488Metagenome / Metatranscriptome201N
F074867Metagenome / Metatranscriptome119N
F082613Metagenome / Metatranscriptome113N
F091607Metagenome / Metatranscriptome107N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0062507_101025Not Available515Open in IMG/M
Ga0062507_102232All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → unclassified Burkholderiaceae → Burkholderiaceae bacterium639Open in IMG/M
Ga0062507_104188Not Available553Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0062507_101025Ga0062507_1010251F082613GPNATTKDAGIYATKIISVTTSASASNILIGHTNVGFAPWKVIPSRGVSSTTGASIGIDGTANITLQTTFANIADNAIFAGTFDVFSHSYLAALTASAFDTIDTREIGVRLKFNSWSSGNVRLDLSVSAKG*
Ga0062507_101381Ga0062507_1013812F025488MAYVSRGFIPQTSLASNLGFTRPMYIPAGNATATALYDIVKVSTSGSTVDTAGVPAGLMGCVRVSDKDDVPCGVIVGFIADPDYLNQTYRSASTARVALVNYDPQVVLEAQEDDNGTTLAVARIGTPVDLVPGSIDTVTGTSGMQISSATLAGSPGMFRLQQRSFAVDNAAIAGTNTKWLVTFNTHQFKATA*
Ga0062507_102232Ga0062507_1022322F074867MSSRGITDIILNGEAFELHPTFSNLDKLETVLNKGAIGFLRQDLSSGAFKTGDVVSIIQVCAVPANGRKFPNWWNRDGVGEAVISAGLVGITTSVTHFLAKAL
Ga0062507_104188Ga0062507_1041881F091607MSLELQISELNATIKTLNENILLLLGGKDQHSKVECSPIEPANLGQTQQQTFLPEVAKSDEYTREQLQSFCLEATKRNAANRDIIKAIMLSNFEARKTGDLADNQINLCYSMI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.