NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300003912

3300003912: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 15



Overview

Basic Information
IMG/M Taxon OID3300003912 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0047180 | Gp0107759 | Ga0063328
Sample NameCompost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 15
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Sao Paulo, Virginia Bioinformatics Institute
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size40469612
Sequencing Scaffolds2
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameCompost Microbial Communities From Sao Paulo Zoo, Brazil
TypeEngineered
TaxonomyEngineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationSao Paulo Zoo, Brazil
CoordinatesLat. (o)-23.651072Long. (o)-46.620675Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059782Metagenome133Y
F105419Metagenome / Metatranscriptome100Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0063328_1036525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria576Open in IMG/M
Ga0063328_1049482All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium1105Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0063328_1036525Ga0063328_10365252F059782MRVEFETARGRVVPGKGSQVAAFFVALEIESEQLTVPERGELLQRLTTRIIDAIAEEFGGEEIEVRRPRE*
Ga0063328_1049482Ga0063328_10494822F105419VRKFIALSALLVAAAAANGCISTTMYGCEITETLAPGASEGEVIMKHGAPDNIVYLGTQYFNPQTGERGEVDKYLYEYRIGGGNTLLGQVFASDEFHNICYLIEGGRVMGGGYVGEGKGSIILGNDFGVLNTPLGSIDLRFGGFLHPKARAGYGGDGNPWGSADVPDNRN*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.