Sample 3300003912

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300003912

3300003912: Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 15

Overview

Basic Information
IMG/M Taxon OID	3300003912 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0047180 \| Gp0107759 \| Ga0063328
Sample Name	Compost microbial communities from Sao Paulo Zoo, Brazil - ZC4 m-RNA DAY 15
Sequencing Status	Permanent Draft
Sequencing Center	University of Sao Paulo, Virginia Bioinformatics Institute
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	40469612
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	1
All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Compost Microbial Communities From Sao Paulo Zoo, Brazil
Type	Engineered
Taxonomy	Engineered → Solid Waste → Zoo Waste → Composting → Unclassified → Compost → Compost Microbial Communities From Sao Paulo Zoo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Soil (non-saline)

Location Information
Location	Sao Paulo Zoo, Brazil
Coordinates	Lat. (^o)	-23.651072	Long. (^o)	-46.620675	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F059782	Metagenome	133	Y
F105419	Metagenome / Metatranscriptome	100	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0063328_1036525	All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria	576	Open in IMG/M
Ga0063328_1049482	All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → unclassified Planctomycetota → Planctomycetota bacterium	1105	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0063328_1036525	Ga0063328_10365252	F059782	MRVEFETARGRVVPGKGSQVAAFFVALEIESEQLTVPERGELLQRLTTRIIDAIAEEFGGEEIEVRRPRE*
Ga0063328_1049482	Ga0063328_10494822	F105419	VRKFIALSALLVAAAAANGCISTTMYGCEITETLAPGASEGEVIMKHGAPDNIVYLGTQYFNPQTGERGEVDKYLYEYRIGGGNTLLGQVFASDEFHNICYLIEGGRVMGGGYVGEGKGSIILGNDFGVLNTPLGSIDLRFGGFLHPKARAGYGGDGNPWGSADVPDNRN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.