 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300004127 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0110114 | Gp0088368 | Ga0008109 |
| Sample Name | High solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-8-D |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 668558554 |
| Sequencing Scaffolds | 4 |
| Novel Protein Genes | 4 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus | 2 |
| Not Available | 1 |
| All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus robur | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa |
| Type | Engineered |
| Taxonomy | Engineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Joint BioEnergy Institute, California, USA | |||||||
| Coordinates | Lat. (o) | 38.5402 | Long. (o) | -121.75 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F031319 | Metagenome | 182 | Y |
| F105011 | Metagenome / Metatranscriptome | 100 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0008109_10126318 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus | 656 | Open in IMG/M |
| Ga0008109_10133820 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus | 641 | Open in IMG/M |
| Ga0008109_10160792 | Not Available | 594 | Open in IMG/M |
| Ga0008109_10211283 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus robur | 530 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0008109_10126318 | Ga0008109_101263182 | F031319 | MHDGETLKAYLDRYCEMYNEMDDNFDDVAISTFKNSLSVGHGLRKSLTSKPATSVRQLMDRIDKYKRVEEDQL* |
| Ga0008109_10133820 | Ga0008109_101338202 | F031319 | VFNEIDGDFDDVAIRTFKVGLLVEHGLRKSLTRKPANNVRQFMDRIDKYKWVEKD* |
| Ga0008109_10160792 | Ga0008109_101607921 | F105011 | MLNLFEKENNDLKAKLKRSEDLYLQCLEDKMKLELKLADVVDGNEIKMDAMRLKIKRIRKYAINREAWYHYAVGSVFTLVAILIAFVVGFKFFR* |
| Ga0008109_10211283 | Ga0008109_102112831 | F031319 | MHYGETLKAYSDRYWETYNEMEDNFDDVAIITFENSLPANHGLRKSLTGKPATSMRQLMDRIDKYKQVEEDQLQGRGKEKVIP* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |