NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004127

3300004127: High solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-8-D



Overview

Basic Information
IMG/M Taxon OID3300004127 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110114 | Gp0088368 | Ga0008109
Sample NameHigh solid enriched microbial communities from the Joint BioEnergy Institute, USA - SP1-8-D
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size668558554
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus2
Not Available1
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus robur1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameIonic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa
TypeEngineered
TaxonomyEngineered → Lab Enrichment → Defined Media → Unclassified → Unclassified → Ionic Liquid And High Solid Enriched → Ionic Liquid And High Solid Enriched Microbial Communities From The Joint Bioenergy Institute, California, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationJoint BioEnergy Institute, California, USA
CoordinatesLat. (o)38.5402Long. (o)-121.75Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031319Metagenome182Y
F105011Metagenome / Metatranscriptome100N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0008109_10126318All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus656Open in IMG/M
Ga0008109_10133820All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus641Open in IMG/M
Ga0008109_10160792Not Available594Open in IMG/M
Ga0008109_10211283All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → eudicotyledons → Gunneridae → Pentapetalae → rosids → fabids → Fagales → Fagaceae → Quercus → Quercus robur530Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0008109_10126318Ga0008109_101263182F031319MHDGETLKAYLDRYCEMYNEMDDNFDDVAISTFKNSLSVGHGLRKSLTSKPATSVRQLMDRIDKYKRVEEDQL*
Ga0008109_10133820Ga0008109_101338202F031319VFNEIDGDFDDVAIRTFKVGLLVEHGLRKSLTRKPANNVRQFMDRIDKYKWVEKD*
Ga0008109_10160792Ga0008109_101607921F105011MLNLFEKENNDLKAKLKRSEDLYLQCLEDKMKLELKLADVVDGNEIKMDAMRLKIKRIRKYAINREAWYHYAVGSVFTLVAILIAFVVGFKFFR*
Ga0008109_10211283Ga0008109_102112831F031319MHYGETLKAYSDRYWETYNEMEDNFDDVAIITFENSLPANHGLRKSLTGKPATSMRQLMDRIDKYKQVEEDQLQGRGKEKVIP*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.