NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004327

3300004327: Sediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC2B



Overview

Basic Information
IMG/M Taxon OID3300004327 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0110188 | Gp0091624 | Ga0066231
Sample NameSediment microbial communities from the mangroves in Sao Paulo State, Brazil - MgvRC2B
Sequencing StatusPermanent Draft
Sequencing Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size26629410
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMetatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Sediment → Mangrove Sediment → Metatranscriptomics Studies In Sediment Microbial Communities From The Mangroves In Sao Paulo, Brazil

Alternative Ecosystem Assignments
Environment Ontology (ENVO)mangrove biomeintertidal zonesediment
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Sediment (saline)

Location Information
LocationSao Paulo State, Brazil
CoordinatesLat. (o)-23.8553Long. (o)-46.1394Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016975Metagenome / Metatranscriptome243Y
F018005Metagenome / Metatranscriptome237Y
F020700Metagenome / Metatranscriptome222Y
F023129Metagenome / Metatranscriptome211Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066231_103869Not Available625Open in IMG/M
Ga0066231_103951Not Available621Open in IMG/M
Ga0066231_104969Not Available573Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066231_103869Ga0066231_1038691F020700MAARHSLHLRFARFDPETSPSVFSDAAAGIAATSIRLNFTVLFQVVRPEKAR
Ga0066231_103951Ga0066231_1039511F023129MKGNLRDKRRDPWHRANALSKAAADPALSGQDANKQQQTCLGLVRKP
Ga0066231_104969Ga0066231_1049692F016975VVKTRRLITDVSWPGSQAGGATTSQSELKSLTQEFSSGNALDGPATRPKTPLAVENSVG
Ga0066231_106477Ga0066231_1064771F018005EKALKSGIDLQEESVNLWKSLLTQLGSPEEFQAKLESMQSEAFPTARKRMEEFIELFNRSSNQTMELFEKSMKVYQAKSVTDAQRRLQDLMESSLETLRGNVQTALNTNAKIVSSWKDIVDRLKSSTKK*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.