NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004572

3300004572: Freshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 14_LOW5 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004572 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114290 | Gp0111162 | Ga0066498
Sample NameFreshwater sediment methanotrophic microbial communities from Lake Washington under simulated oxygen tension - Sediment Metatranscriptome 14_LOW5 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size23263978
Sequencing Scaffolds5
Novel Protein Genes5
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia1
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1
Not Available2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameFreshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Methanotrophic Microbial Communities From Lake Washington Under Simulated Oxygen Tension

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater lake biomefreshwater lakelake sediment
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Sediment (non-saline)

Location Information
LocationUSA: Lake Washington, Seattle, Washington
CoordinatesLat. (o)48.3807Long. (o)-122.1599Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001633Metagenome / Metatranscriptome660Y
F006508Metagenome / Metatranscriptome371Y
F053640Metagenome / Metatranscriptome141Y
F082737Metagenome / Metatranscriptome113Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066498_100051All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Escherichia566Open in IMG/M
Ga0066498_109295All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila752Open in IMG/M
Ga0066498_147366Not Available530Open in IMG/M
Ga0066498_159686All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae → Enterobacter → Enterobacter cloacae complex → Enterobacter hormaechei500Open in IMG/M
Ga0066498_160603Not Available711Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066498_100051Ga0066498_1000511F053640RSAAALKNVTESTAGIIPGDRGMVGDNWCRPPLQAAKVVERHISPVPLAGVVSGQYTHEVGTERRGAIRNRVEPSQAHGAFRPVRRRSYPRGFWLLLRRPERSHGFRRANPAKRPRSQHERGAQGNRDGGEGAGLAKPVKPPQWGGAKNRVTPLQKRKQP*
Ga0066498_109295Ga0066498_1092951F001633TRLGALAFAGGVLPDATLRGMRMFRSHGGTVLTVTGRDLLSEASSPGSDAPCRERRAGRGADTPAIFIVSRLHPYHEDGTGFWPAVGPALRV*
Ga0066498_147366Ga0066498_1473661F082737SLQLAPQPACQV*ACHIQPAGRCSRLAPRPRYFSVGASMLSGPPASLPVRSQNLETDFHSPTKTNLLPDRRGGVRVPALPLQLCGTLAVSPVRSDLHPRPVSRTAWDFYDQNPLLPDPAPLQPASLNRCSPSGLFALPDHSTQSRWPTGNLLPATPDLPSLPTGGRIRYQHQRIIV
Ga0066498_159686Ga0066498_1596861F001633LAFAGGVLPDATLRGMRMSRSHGGTVLAVTGRDLSSEASSPGSDVPCRERRAGRGADTPAIFIVSRRHPYHGDGTGFWPIVGPALRV*
Ga0066498_160603Ga0066498_1606033F006508VVLANAPSKAVADQYQVVKTRSQSYRRVLTWFASRWRNHQPKRAEKPHSKFSVVRRWTALHEAEDPLAVENSVGK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.