x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300004859
3300004859: Chicken cecum microbial communities from Brno, Czech Republic, of chickens treated with various antibiotics - Lincosamide treated
Overview
Basic Information |
IMG/M Taxon OID | 3300004859 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114608 | Gp0114667 | Ga0071333 |
Sample Name | Chicken cecum microbial communities from Brno, Czech Republic, of chickens treated with various antibiotics - Lincosamide treated |
Sequencing Status | Permanent Draft |
Sequencing Center | Masaryk University |
Published? | N |
Use Policy | Open |
Dataset Contents |
Total Genome Size | 69229515 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny |
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae | 1 |
Ecosystem and Geography
Ecosystem Assignment (GOLD) |
Name | Chicken Cecum Microbial Communities From Brno, Czech Republic, Of Chickens Treated With Various Antibiotics |
Type | Host-Associated |
Taxonomy | Host-Associated → Birds → Digestive System → Ceca → Unclassified → Chicken Cecum → Chicken Cecum Microbial Communities From Brno, Czech Republic, Of Chickens Treated With Various Antibiotics |
Alternative Ecosystem Assignments |
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
Location Information |
Location | Brno, Czech Republic |
Coordinates | Lat. (o) | 49.19522 | Long. (o) | 16.60796 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
Zoom: |
Powered by OpenStreetMap © |
Associated Families
Family | Category | Number of Sequences | 3D Structure? |
F004815 | Metagenome | 422 | Y |
Associated Scaffolds
Scaffold | Taxonomy | Length | IMG/M Link |
---|
Ga0071333_128508 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae → Galloanserae → Galliformes → Phasianidae → Phasianinae | 662 | Open in IMG/M |
Sequences
Scaffold ID | Protein ID | Family | Sequence |
Ga0071333_128508 | Ga0071333_1285081 | F004815 | LQAFKARLDVALGSLGCWLATLHIAGGWNWMSTVVLFNPGHSVIL* |