NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300004974

3300004974: Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_200m_RNA (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300004974 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0046785 | Gp0111050 | Ga0066617
Sample NameMarine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI047_200m_RNA (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size132177188
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available5
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Expanding Oxygen Minimum Zones In The Northeastern Subarctic Pacific Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → coastal inlet → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationBritish Columbia, Canada
CoordinatesLat. (o)48.6Long. (o)-123.5Alt. (m)N/ADepth (m)200
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F023595Metagenome / Metatranscriptome209Y
F029271Metagenome / Metatranscriptome189N
F034189Metagenome / Metatranscriptome175Y
F052640Metagenome / Metatranscriptome142N
F075397Metagenome / Metatranscriptome119N
F088317Metagenome / Metatranscriptome109Y
F096688Metagenome / Metatranscriptome104N
F097453Metagenome / Metatranscriptome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0066617_1000117Not Available602Open in IMG/M
Ga0066617_1240028Not Available611Open in IMG/M
Ga0066617_1274712All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales → Desulfobacteraceae → Desulfatirhabdium → Desulfatirhabdium butyrativorans673Open in IMG/M
Ga0066617_1277487Not Available843Open in IMG/M
Ga0066617_1279371Not Available799Open in IMG/M
Ga0066617_1307439Not Available528Open in IMG/M
Ga0066617_1315646All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Dehalococcoidia → unclassified Dehalococcoidia → Dehalococcoidia bacterium796Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0066617_1000117Ga0066617_10001171F096688VFYAIDRMSLGQIMRGKFMRIIKGLAVVGYASIMLLVLTGGRSANEAEFNAGHQACDAQYNMDAMQAFEMDASEPFVQCHVAVNEAYPAAWNNWRRQNARSRGLELAGNRFRGGGGC*
Ga0066617_1240028Ga0066617_12400281F052640MSNPSIKTIDELEAQYYGYNRNFLRKADSPVTTSTAGVFNAIFGAYAWAQLN
Ga0066617_1274712Ga0066617_12747123F023595MIDFGSGQGLNIFATAGIARYFEDCKKVKTPAWAKRCRFWM
Ga0066617_1277487Ga0066617_12774872F029271MSKLSDLQDIKELLDVDFRKDKFLDNQYNNSPCFNYDAAESYVANIHQFLSEKYGEAVIYNFMQEVESLRITTLKMYIESNIASYQKFGAQK*
Ga0066617_1277487Ga0066617_12774873F075397MKYWHKRVEVVSFFDLDQESQAAELKDDDNAEELAFLIAENGDEYWNLDLFMRTESGRYDGVMGLTNTSAIGVVLSCSGESAVIQCFG*
Ga0066617_1279371Ga0066617_12793711F034189MTTNLAKWASNDGQITKSGLPNDRRAKFLPSVVGFAYDLLRYEYYLGNIGLRHCFA*
Ga0066617_1307439Ga0066617_13074391F097453CNNNEIDKGEVVMYDLILRDVESVFGNAVWTTNNIKTYPMNYLGSKSSSTEYVLLNVLPSSSRNYAYGVSKETTGLVAVKIFVKAGDGQGRLMAIANLLDTVLDNKTLPNGTKLGTSYLTVEGLDPSNKALYSASYIIPFTHYGE*
Ga0066617_1315646Ga0066617_13156461F088317MPGPEDKIQYPAHEAISQDAVSGNRPMKRRDLWYGEHDAPPLPALDKSQLVRWLESGGKEEEEARYVMMPPPELPYRKLPVSTKFISCNTRHLKEIGAFRTILPEMFGEAGYKAVDDCYASFAYAEFRSAQKRGQLKSAPNCSATEIGTFIATVYDIQNFPIVIAEASDERVRIQLYKGLPVYCPYDVRRGDYRLCAATAAYERELVKLCNPKLHAFLSRTKAIGDDCCELTIEKDPNA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.