NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005287

3300005287: Hoatzin crop microbial communities from Cojedes, Venezuela - Epithelial fraction 12



Overview

Basic Information
IMG/M Taxon OID3300005287 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0060822 | Gp0051908 | Ga0065711
Sample NameHoatzin crop microbial communities from Cojedes, Venezuela - Epithelial fraction 12
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size1305838063
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae1
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHoatzin Crop Microbial Communities From Cojedes, Venezuela
TypeHost-Associated
TaxonomyHost-Associated → Birds → Digestive System → Crop → Lumen → Hoatzin Crop → Hoatzin Crop Microbial Communities From Cojedes, Venezuela

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal proximal gut

Location Information
LocationCojedes, Venezuela
CoordinatesLat. (o)8.956944Long. (o)-68.299167Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004001Metagenome457Y
F026176Metagenome / Metatranscriptome198N
F053715Metagenome / Metatranscriptome140N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0065711_1041157All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Archosauria → Dinosauria → Saurischia → Theropoda → Coelurosauria → Aves → Neognathae16367Open in IMG/M
Ga0065711_1193621Not Available547Open in IMG/M
Ga0065711_1194635Not Available544Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0065711_1036248Ga0065711_103624827F004001ESPSLEVFKKRADMALQDWFSRHGAVVLIVGLDDFRGLFQPVIL*
Ga0065711_1041157Ga0065711_10411572F004001LHWNRLPREAVESPPLEMLKKYVDVALQTWFKRHGGDGLVVGLDDLGGLFQP*
Ga0065711_1193621Ga0065711_11936211F053715MNMYFPGANSQNIPKSYDPDVLEGNWFEDRCTSTYDNKKKRDFLLPNPNQWQYDTTYQELGHHCKDYPTLKKHFQICNDNFINFQGMDYNMFITTNKHAMDPRYRLTFREPVNTRDYYKYRQPELEKYRMEWTHKEQLFDTTYQKDILDKIPLFQNKTFNITALN
Ga0065711_1194635Ga0065711_11946351F026176YLGFVSSIKAENKISESYGKETAQSLAGTIPKGADVPPYVRYTSTYREDYKDQSKVRTQSTAQLLGITQPKVEYKKSIPVDTINKFFGVHPDNNSTEKEKCIQEKQSGEKDYEKFWNFVNQNDLDYVEKKPDDINESNMAYWGVPHSVQELHPELKYDPIPGYMGTYKHIIPENIFGLTY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.