 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005377 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0056617 | Gp0051025 | Ga0074217 |
| Sample Name | Marine planktonic communities from Hawaii Ocean Times Series Station (HOT/ALOHA) - 3_Base_of_chrolophyll_max_130m |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | Y |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 6007257 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 2 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 3 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha) |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine → Marine Planktonic Communities From Hawaii Ocean Times Series Station (Hot/Aloha) |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine biome → marine photic zone → sea water |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | North Pacific Ocean at depths of 10m to 4000m at the Hawaii open-ocean time-series station | |||||||
| Coordinates | Lat. (o) | 22.45 | Long. (o) | -158.0 | Alt. (m) | N/A | Depth (m) | 130 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F007891 | Metagenome / Metatranscriptome | 343 | Y |
| F023490 | Metagenome | 210 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0074217_10463 | Not Available | 792 | Open in IMG/M |
| Ga0074217_12969 | Not Available | 966 | Open in IMG/M |
| Ga0074217_16257 | Not Available | 1050 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0074217_10463 | Ga0074217_104632 | F007891 | MTLYSNFFSSAINSVETKEKEVLITYSSNIAKEYVYNCENVPEFTNNLCSVLISNELQQDGGSVGSFVSQSRRDGVLTDQ* |
| Ga0074217_12969 | Ga0074217_129693 | F023490 | MILFPTHGWNTNFPISNTNSSVVYYRERPGPNFFRVFYKNVAQIRYTPKQVGAVFGVARFTPSVNELRDWCYEMVKEYGSETDKADDGYLKYIAKHGFGPEVHQDEDPTANTKMIV* |
| Ga0074217_16257 | Ga0074217_162571 | F007891 | MTLYSNFFSSAIESVETKENTVFITYSSNLEKNYEYNCTNVEEFTNNLCSVLIDNELQRDTGSVGRFIQQSRRDSVLTDK* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |