NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300005378

3300005378: Marine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 52-4 In plume



Overview

Basic Information
IMG/M Taxon OID3300005378 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0047147 | Gp0052348 | Ga0074273
Sample NameMarine microbial communities from Deepwater Horizon subsurface plume in Gulf of Mexico, 52-4 In plume
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?Y
Use PolicyOpen

Dataset Contents
Total Genome Size52555614
Sequencing Scaffolds3
Novel Protein Genes6
Associated Families5

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2
All Organisms → cellular organisms → Eukaryota1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Subsurface Plume → Marine Microbial Communities From Deepwater Horizon Subsurface Plume In Gulf Of Mexico

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine black smoker biome → black smoker → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Subsurface (non-saline)

Location Information
LocationGulf of Mexico
CoordinatesLat. (o)28.716667Long. (o)-88.466667Alt. (m)N/ADepth (m)1210
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002457Metagenome / Metatranscriptome557Y
F002556Metagenome / Metatranscriptome548Y
F030135Metagenome / Metatranscriptome186Y
F098669Metagenome / Metatranscriptome103N
F103410Metagenome / Metatranscriptome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0074273_109730Not Available747Open in IMG/M
Ga0074273_112137Not Available504Open in IMG/M
Ga0074273_140186All Organisms → cellular organisms → Eukaryota530Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0074273_109507Ga0074273_1095071F103410RLTAWTVPQIAADPKERSNLLSSPTNPDEPTGNPFDALISMPAQHILGRTPEGTSRTVLTDQIGLPKVSRSPQRRTFLHHPEASLEHASFRLLYHKTAQKLFSDTADHFCQHLRRHARVPDPGPAHRHSDDPKITFLPISLAFDRLAQGPHDPGHTTPEGFACRFGCSTAPLLPGGIATTVSQPSQSTQRPLGHLTLCRTIRPEGHIEGLGSRNTIHSKHSKVTRSGTFQPFP
Ga0074273_109730Ga0074273_1097301F030135LGFLRGPKNREELATLSSFTNIWHSTFAGCQFPDAILPGKEAIDLVAGPLN*
Ga0074273_112137Ga0074273_1121371F098669METATRSRKQKWRLKEAEGLGRKRRVEEAERRELHESDQGLDPGHGLNPGRKVRRIDQAMEGSPEIVPAKIRKKPCL
Ga0074273_128297Ga0074273_1282971F002457FDFLCEKVAAMPRRFGLAPSWEAEYGGSIEKRTAARKAMFDAVDAKQGPARGWIGAAQFTDWATTHIGGKIAAIDNVKEVDFYHVSNYDEAAFLKAIEIAVTNKNSKEYASLYEFLLTAFVEVDATCRGEITFSEFNALVERAAAVPRTFGLAPPDGTAEERKAIFSAMDDTKTVLITVRKFLEWVVSHTAGKVEAQKAGKGYKK*
Ga0074273_140186Ga0074273_1401861F002556IGLEQFVTWATDHLITKVATIDIKSEVDFYHVEQYGEHQTLVFLEQAVTDPNSRAHASLYEFLLAIFTEVDSRSTGVLTFAEFDTLLSRAAEVPRTFGLAPPDASKEIRKQFFDSMNDAQMGGVTFRTLLAWTVEHTKGKIEAQKAGKGYKK*
Ga0074273_144301Ga0074273_1443011F103410VVKRCRPKGLQSLIASLPGPSHKSPQTRRSAATCFLAQPIPTNPRASPFDALISMPAQHVLGRTPEGTSRTVLTDQIGLPKVSRSPQRRTFLHHPEASLEHASFRLLYHKTAQKLFSNTADHFCQHLRRHARVPDPGPAHRHSDDPKITFLPISLAFDRLAQGPHDPGHTTPEGFACRFGCSTAPLLPGGIATTVSQPSQSTQRPLGHLTLCRTIRPEGHIEG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.