 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300005461 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0114692 | Gp0115680 | Ga0073906 |
| Sample Name | Mouse cecum microbial communities from Vienna, Austria - Inoculum for glucosamine and mucus D2O microcosms |
| Sequencing Status | Permanent Draft |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 587582577 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Mouse Cecum Microbial Communities From Vienna, Austria |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Mammals → Digestive System → Large Intestine → Cecum → Mouse Cecum → Mouse Cecum Microbial Communities From Vienna, Austria |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Austria: Vienna | |||||||
| Coordinates | Lat. (o) | 48.2 | Long. (o) | 16.37 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F051936 | Metagenome | 143 | N |
| F059106 | Metagenome | 134 | N |
| F076190 | Metagenome | 118 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0073906_1047255 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides | 1635 | Open in IMG/M |
| Ga0073906_1162528 | Not Available | 626 | Open in IMG/M |
| Ga0073906_1169685 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 606 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0073906_1047255 | Ga0073906_10472551 | F051936 | EQEGTGQVLFFPLALRGKAFGFNMLQEHAVMTPAISISFKTLIIKYLSIYISIKK* |
| Ga0073906_1162528 | Ga0073906_11625282 | F059106 | VWKIRVILLQTFVWIVDLKVREHLTEYLKKDIKYHRVIIGVLV* |
| Ga0073906_1169685 | Ga0073906_11696851 | F076190 | ASRVSGRVWSLVRITVPNDLKSVRIRVEKPQNNSLYPYFQREPL* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |