Sample 3300005697

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005697

3300005697: Human fecal microbial communities J Craig Venter Institute, Maryland, USA - Subject 8

Overview

Basic Information
IMG/M Taxon OID	3300005697 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0056641 \| Gp0051096 \| Ga0074229
Sample Name	Human fecal microbial communities J Craig Venter Institute, Maryland, USA - Subject 8
Sequencing Status	Finished
Sequencing Center	J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	20492925
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Fecal Microbial Communities From The State University Of New York At Buffalo, New York, Usa, Of Three Healthy Adults
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From The State University Of New York At Buffalo, New York, Usa, Of Three Healthy Adults

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location	J Craig Venter Institute, Rockville, Maryland, USA
Coordinates	Lat. (^o)	39.134321	Long. (^o)	-77.181702	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067844	Metagenome	125	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0074229_102618	Not Available	847	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0074229_102618	Ga0074229_1026181	F067844	ASVWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAAVITPQHRSYRVPQGSPQVFGGP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.