Sample 3300005777

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300005777

3300005777: Human lung microbial communities from Normal Smoker Supraglottic 110406-1

Overview

Basic Information
IMG/M Taxon OID	3300005777 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0116053 \| Gp0118725 \| Ga0078393
Sample Name	Human lung microbial communities from Normal Smoker Supraglottic 110406-1
Sequencing Status	Permanent Draft
Sequencing Center	New York University Langone Medical Center
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	34379873
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Lung Microbial Communites From Healthy (Non-Smokers And Smokers) And Hiv Infected Subjects
Type	Host-Associated
Taxonomy	Host-Associated → Human → Respiratory System → Lung → Unclassified → Lung Microbiome → Human Lung Microbial Communites From Healthy (Non-Smokers And Smokers) And Hiv Infected Subjects

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal corpus

Location Information
Location	New York City, New York, USA
Coordinates	Lat. (^o)	40.7127	Long. (^o)	-74.0059	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F054110	Metagenome	140	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0078393_138850	All Organisms → Viruses → Predicted Viral	1193	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0078393_138850	Ga0078393_1388502	F054110	MNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVRTYKGGD*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.