Sample 3300006170

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300006170

3300006170: Saline water microbial communities from Bras del Port Salterns, Alicante, Spain - SS33

Overview

Basic Information
IMG/M Taxon OID	3300006170 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0075597 \| Gp0121559 \| Ga0082040
Sample Name	Saline water microbial communities from Bras del Port Salterns, Alicante, Spain - SS33
Sequencing Status	Finished
Sequencing Center	GATC-Biotech AG, Konstanz, Germany
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	35911006
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Host-Associated → Human Host-Associated Microbial Communities From Fecal Samples Of Mother And Infant In Denmark

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	aquatic biome → saline evaporation pond → saline water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Hypersaline (saline)

Location Information
Location	Spain: Santa Pola, Valencian Community
Coordinates	Lat. (^o)	55.678	Long. (^o)	-0.555207	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F076468	Metagenome	118	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0082040_106727	Ga0082040_1067272	F076468	TSDMSQRDIADAVGHPRGTVGIIFRERAPMTKLEEIDTKAVWLSGRYWRREHKVVHIDGDCDQLDACDNPRGPVDPDVLAGDMSVCKRCDPNEPDRYGGTTGTSLAHRLRDGDLQDATLDCDTGGDE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.