NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006197

3300006197: Intestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t30_690M_inflammed - microbial_metagenome



Overview

Basic Information
IMG/M Taxon OID3300006197 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114764 | Gp0121224 | Ga0081177
Sample NameIntestinal microbial communities from Inflammed Rag1 mice from UTSWMC, Dallas, Texas, USA - t30_690M_inflammed - microbial_metagenome
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Texas Southwestern Medical Center
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size200803021
Sequencing Scaffolds1
Novel Protein Genes1
Associated Families1

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameIntestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Unclassified → Unclassified → Mouse Feces → Intestinal Microbial Communities From Inflammed Rag1 Mice From Utswmc, Dallas, Texas, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
LocationUTSWMC, Dallas, Texas, USA
CoordinatesLat. (o)32.73Long. (o)-96.97Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F059106Metagenome134N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0081177_1038386Not Available819Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0081177_1038386Ga0081177_10383861F059106LQTFVLIVDLKVREHLTEYLKKDIKYHRVIIGVLV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.