NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300006689

3300006689: Metatranscriptome of deep ocean microbial communities from South Indian Ocean - MP1240 (Metagenome Metatranscriptome)



Overview

Basic Information
IMG/M Taxon OID3300006689 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053074 | Gp0092403 | Ga0031669
Sample NameMetatranscriptome of deep ocean microbial communities from South Indian Ocean - MP1240 (Metagenome Metatranscriptome)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size48665943
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationWest of Perth, Australia, South Indian Ocean
CoordinatesLat. (o)-31.13Long. (o)110.21Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F007220Metatranscriptome355N
F030135Metagenome / Metatranscriptome186Y
F042932Metagenome / Metatranscriptome157N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0031669_1009717Not Available725Open in IMG/M
Ga0031669_1104524Not Available685Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0031669_1009717Ga0031669_10097171F030135KNREELATLSSFTDIGHATFVGCQFPDAILPGGEAIDLVAGPLN*
Ga0031669_1104524Ga0031669_11045241F042932EKYDDQVEITKSDEEQDSYENTVAKSIDTLADVVQSIAESQQGVEKAITTIVERVKALETPSDLPLSPKGTQGGDDVGAKVTAPNDPYPVGDQVGLDSDRRSKNPPKKDPAGLKMQEKPVNKAVEDEPEEVVEESRPEMVTKSQHEFSTETPRPGSAPETVDKSFTKDFSPILKDARENGYEGLSIVAQNILSGKYYKPTPEEIGILIWSKYEPLMN*
Ga0031669_1115939Ga0031669_11159391F007220SYWGYSAQQCQTWMNGELSRLNQEVADMQNAGSLTGRKKAAALAKGIKAQETLNKYSQCNVFWQPIDAAPLTSGGNGYVDGGDVDISNFERDNYPAAPLTDGTDGYSETKTLDATAPLTDGSYSETKTVDSAPLTDASYSETKTVDAAPLTDGSYSEPKTAPQIDAGEYTADSADLTGYV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.