Sample 3300006692

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300006692

3300006692: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP0101 (Metagenome Metatranscriptome)

Overview

Basic Information
IMG/M Taxon OID	3300006692 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0053074 \| Gp0092395 \| Ga0031661
Sample Name	Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP0101 (Metagenome Metatranscriptome)
Sequencing Status	Permanent Draft
Sequencing Center	DOE Joint Genome Institute (JGI)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	62958440
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Deep Ocean Microbial Communities From The Global Malaspina Expedition
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	North of Cape Verde, Atlantic Ocean
Coordinates	Lat. (^o)	21.45	Long. (^o)	-23.45	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030135	Metagenome / Metatranscriptome	186	Y
F036196	Metatranscriptome	170	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0031661_1121493	All Organisms → cellular organisms → Eukaryota	905	Open in IMG/M
Ga0031661_1138829	Not Available	746	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0031661_1121493	Ga0031661_11214931	F036196	VLSPWGTDHWRHDKKAFIAWCKEAIREDSKARRELYGFAALNFGDVDTDKDGFINQGQFDRYLESVAAIPRRFGLAPVSSVDRSARLANHTVIFDQIDAKDGPARGKLGLDQVLRWTIDHVAGKISQIPEGDVGLYHVEDYSEAEYVGFIERAVNKPGSYEHVSFYNFILNVFIEADTQCEGRVTYDQFGKLLSRAAKVPRHFGLAPADVDESVRKAMFKAMELKRDGVPQGFVTHRKFWEWTVEHTKMKIDLQKAGKGWRENH*
Ga0031661_1138829	Ga0031661_11388292	F030135	NREELATLSSFTDIWHSTFAGCQFPDAILPGKEAFDLVAGPLN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.