NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007132

3300007132: Human buccal mucosa microbial communities from NIH, USA - visit number 3 of subject 763536994



Overview

Basic Information
IMG/M Taxon OID3300007132 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063646 | Gp0052648 | Ga0103282
Sample NameHuman buccal mucosa microbial communities from NIH, USA - visit number 3 of subject 763536994
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size52576659
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1
All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F033081Metagenome178Y
F094007Metagenome106N
F101360Metagenome102N
F103434Metagenome101N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103282_100040All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes42725Open in IMG/M
Ga0103282_118297All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria641Open in IMG/M
Ga0103282_118485All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Saccharibacteria637Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103282_100040Ga0103282_10004010F103434VVGFRPRRGRYLENGPHVVEVTLAVVKEGRTGRRFERGETFVIDKVLVQQSAGNALKATENRVIRGDLTDETTLKVFGTGRKWPGGPHSWVKIIKGPESLVGKTFQQAGEPLTYDASPMTRHWSVCCDTLGTESR*
Ga0103282_100040Ga0103282_10004039F101360VSKENALRRAAIAAHVAKVASQEKKKALKELEEYMAPGDTSKPMIDGLQVGTVSVSAPQPRYQVVDEKALVAWLEWNKPDAVHKVPAPWFVAAAALDGFIKQTGEVPDGVEVVQGDPRISVRISTSQEEAIRELISTGDISILEIESGDA*
Ga0103282_118297Ga0103282_1182971F033081PLVYRPKKGVMAWLFRRAMPQDTRPTFVWSRLVTEIENAGYFSRRKFSILAVGLIIMTIATIKMLLFVPGLNQSVVSLLTRGLETFLPTGWATATAWTVGMSGVFLMGDFTNYTPSQMFLHKIKATRYEVYNIILFLALLEEQAFRSGSERWNWRERVRASVCFGLLHIANIWYSFAAGIALSVTGFGFLLVYLWYYRKYRIQIIATAAASDW
Ga0103282_118485Ga0103282_1184851F094007MKSKTVEVLELARPNRAGVIDVVDSDGNVVPLDYLGEDFVPDVNSYSDEDFTKRNRIIVEMCDLFGRIRRRAGFAECHRGRGDYDRARRIERNRGSDISEVGRLAISACEACPLKLDCELYGKLGGAVLSGVLDYKKVRTATSLTKAGKKRSGWNKGCIDNNA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.