 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300007264 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0116043 | Gp0118655 | Ga0079921 |
| Sample Name | Hydrothermal vent microbial communities from Teddy Bear hydrothermal vent, East Pacific Rise - large volume pump, sample 8 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Bigelow Laboratory Single Cell Genomics Center (SCGC) |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 42911142 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Hydrothermal Vent Microbial Communities From Teddy Bear Hydrothermal Vent, East Pacific Rise |
| Type | Environmental |
| Taxonomy | Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Fluid → Hydrothermal Vent Microbial Communities From Teddy Bear Hydrothermal Vent, East Pacific Rise |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Subsurface (non-saline) |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | Teddy Bear Hydrothermal Vent, East Pacific Rise | |||||||
| Coordinates | Lat. (o) | 9.847222 | Long. (o) | -104.2975 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F005608 | Metagenome / Metatranscriptome | 395 | Y |
| F006198 | Metagenome / Metatranscriptome | 379 | Y |
| F025922 | Metagenome / Metatranscriptome | 199 | Y |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0079921_1001865 | Not Available | 830 | Open in IMG/M |
| Ga0079921_1010604 | Not Available | 532 | Open in IMG/M |
| Ga0079921_1012544 | All Organisms → cellular organisms → Archaea → TACK group → Thaumarchaeota → Thaumarchaeota incertae sedis → Marine Group I → Marine Group I thaumarchaeote | 509 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0079921_1001865 | Ga0079921_10018651 | F025922 | MARNRIIYGSQSVWVNGDVLYRVQTLGSTASFTSEDIFELGSLDIIDAVDDTPNVSVTLNTNDFGDLGTLATLAQLSPAKKAMDATADATNANLQVVDAALAATGTFLHGACLSDFAVTCGSLTGVTLWAPVQDECSIGSLANNIDQTLFMDEVYVNSLEFSYSSGANATENYGAETDNKMWLLNDGRFVNYDKYVLDAGAVGDGYVDLTLAAASDIAVLSTGLG |
| Ga0079921_1010604 | Ga0079921_10106042 | F006198 | MEVELDVECDNCPATYTMVYDSDDIQSQNQEEHAFHCAFCGILMEPYYNEEEI* |
| Ga0079921_1012544 | Ga0079921_10125443 | F005608 | MKKATIEVLEEGELIFGSPTVGKYFVRRYEDGEEMGGGFFKTKKEAVTHVREYNKSE* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |