NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007302

3300007302: Human anterior nares microbial communities from NIH, USA - visit 1, subject 158984779 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007302 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0052721 | Ga0104927
Sample NameHuman anterior nares microbial communities from NIH, USA - visit 1, subject 158984779 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size13554487
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Respiratory System → Nasopharyngeal → Anterior Nares → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018385Metagenome235Y
F027205Metagenome195N
F043991Metagenome155N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0104927_101966All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1017Open in IMG/M
Ga0104927_102506All Organisms → cellular organisms → Bacteria893Open in IMG/M
Ga0104927_104178All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes658Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0104927_101966Ga0104927_1019662F018385MMAEYENQWGPYKEHSIEKDRDPVLDDPIIYGVNVKHFTVTVYSQDGRVNKYWNARILKDDLGCCRIACPRDGKILCFNWVHWTAYMFTHDGLNELVFMPGSSRKTISRLYHEEVK*
Ga0104927_102506Ga0104927_1025063F027205VASRLIVSADDILKAVKESEEFEKKALSEARKRDRAEGKEPRETLYPNPDLKPGREIVLDYIKNPERRRTPRCSVHLEKRTANNSYRFIVDVSQVRNRELADEIEKDLFAFMDYVLDEYDIPRRIKRSAK*
Ga0104927_104178Ga0104927_1041782F043991MSKKNPSVIDYFDLNGDLNEEAYEFEDVKLEEYIDKRSNVKPSWIGKYSHQMHFDLADDTEVSFYKGLNIVYADINFAGGIRTILFKCRQKKNLTRFISRVLEIAQGDPSNVHPDFRA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.