x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300007529
3300007529: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 550534656 reassembly
Overview
Basic Information
IMG/M Taxon OID 3300007529 Open in IMG/M
GOLD Reference (Study | Sequencing Project | Analysis Project) Gs0063646 | Gp0052760 | Ga0105488
Sample Name Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 550534656 reassembly
Sequencing Status Permanent Draft
Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published? N
Use Policy Open
Dataset Contents
Total Genome Size 5632913
Sequencing Scaffolds 1
Novel Protein Genes 2
Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Type Host-Associated
Taxonomy Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location USA: Maryland: Natonal Institute of Health
Coordinates Lat. (o ) 39.0042816 Long. (o ) -77.1012173 Alt. (m) N/A Depth (m) N/A
Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F027205 Metagenome 195 N F074985 Metagenome 119 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0105488_100001 All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes 28220 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0105488_100001 Ga0105488_10000133 F027205 VASRLIVSADDILKAVKESEEFEKKALSEARKRDRAEGKEPRETLYPNPDLKPGREIVLDYIKNPERRRTPRCSVHLEKRTANNSYRFIVDVSQVRNRELADEIEQDLFAFMDYILDEYDIPRRIKRRTK* Ga0105488_100001 Ga0105488_10000135 F074985 MELTDGGWYKTPRIIKGKDFLAHIHDTYASGNAMYVEFKASEGEVRILEYQRLYDVDTESAVLFTINTFPQESILLKNIEEYEFIQYRPQTAWKAIHMGSTKRINLEQFDQIWLDQTFQKLHPVIVNHDGKFWHVMGLKLDVDADGSFWGLYLKRQDSDFMKEIRMPLTQKFIYNPISGSWSLDDPTQEIKDLEQIKKSLKSEDVSEVIVSGVPMKLIRVQEIAKGVLFFVFQDEEKNKRYYYNRPAIKLRIVTDSETGEQKYLLDHIKAMYID*