NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007753

3300007753: Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159591683 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007753 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063646 | Gp0052849 | Ga0105778
Sample NameHuman tongue dorsum microbial communities from NIH, USA - visit 1, subject 159591683 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size78653717
Sequencing Scaffolds3
Novel Protein Genes4
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F054110Metagenome140N
F067846Metagenome125Y
F073671Metagenome120N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0105778_100652All Organisms → cellular organisms → Bacteria11686Open in IMG/M
Ga0105778_102445All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Negativicutes → Veillonellales → Veillonellaceae → Veillonella5125Open in IMG/M
Ga0105778_118168All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes875Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0105778_100652Ga0105778_10065211F073671MNKEHAEHELAELHEKERSLEKALELVREKIRELVNYTDKNKV*
Ga0105778_100652Ga0105778_1006525F067846MSIIAEWERQEFNKWDKQCSKEDDYNRAVEMEIEAIKEDIANCDSDALCAFSEKMFDDDEFLKAVALGTDYEEMRIKILTAMAEDRLEQLEKDYKNGYILND*
Ga0105778_102445Ga0105778_10244510F054110VNYQPTIKKLLKALQMNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKAKQLYKKESEYSSTKQHEVLLFLVKTYKGGD*
Ga0105778_118168Ga0105778_1181681F054110VLDVNYQPTIKKLLKALQMNGRRYVVDVRQSWSKYDKPCKVYIVNRMYTEEEYKLTFPHKYKKGKTFKQGQLYKKESEYSSTKQHEVLLFLVRTYKGGD*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.