NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300007806

3300007806: Human stool microbial communities from NIH, USA - visit 1, subject 764042746 reassembly



Overview

Basic Information
IMG/M Taxon OID3300007806 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063646 | Gp0052873 | Ga0105890
Sample NameHuman stool microbial communities from NIH, USA - visit 1, subject 764042746 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size79849403
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales2
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae1
All Organisms → cellular organisms → Bacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032312Metagenome / Metatranscriptome180N
F055775Metagenome138N
F073656Metagenome120N
F080163Metagenome115N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0105890_100487All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales27472Open in IMG/M
Ga0105890_100622All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales20861Open in IMG/M
Ga0105890_104498All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales → Enterobacteriaceae2362Open in IMG/M
Ga0105890_108595All Organisms → cellular organisms → Bacteria1092Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0105890_100487Ga0105890_10048721F055775MAQIAQQDNLVIEVTTTTAALEDATKKKLIECIEGGTITDVILVTKEAEKKISHARVVSWLVDTTGDSPKYTIDIINASSGAVEAIALN*
Ga0105890_100622Ga0105890_1006226F073656MTMEQDQEQMQGALYVAVDDGNKIIAMERSRRGDEGFRALLDEFTDYAANCGAIPSVLFFDIRTTDAALLPRIEAAEHSYLLDPSTATEKLDIRHAVTLKDLLYCYKYDLDPLAEGNCGNMLSTKADYRQFRNEGLPPVAREDLRRCRAVETERGTVLFTQEPDGREACERYMQHHADCFFDPDLGVETLRVYEVEADPDGFWDKVNPQVLPTAGGMMWVPEHPFVDAEVLRRGYCLKEYDMRATADNFWAFVNPQHGENLYVSNGIRDLTGLQIIMQRGYGYLMQNAERYWNREFVFRSGFDNIERKYASDLSDEGRAAKREEQYNLAAYILDRKFPIRRRPSSEIPPMQAEGIRTFRNFDAINLLFRPDKLLEAYQRRRDEPVRGTEFHLKRH*
Ga0105890_104498Ga0105890_1044982F080163MKTIKFLQESFETKERFQQEISIKYSYNQDTVESIDFRINQCNIRYFYEAMQNFENSLVNEFKEKKNNFCDAKQFLESINDFDRILFIIITYMKTYFDSCKDYSEINLHVHLVQFDFTTSVLIQGFYNYTTHRDLSFSTRLENNILDSEIELLQEKLDLIREELCELIGIDPDLQKKGHEENYIFNLNINSDNQIGFLLQATDL*
Ga0105890_108595Ga0105890_1085953F032312MARIKDYDEDLSAPKLLRERARDSKGRFIKKDLPPYLGSEQVLKPKNYYHFDSHGNYKGSSMNFDALVCLGFTWFKLLGVALMMLLWPIVFIYAVLHDGIEGYPFKKYAIPYIFILVAWFIIFLYGLVS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.