Sample 3300007852

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300007852

3300007852: Non-marine hypersaline water microbial communities of A?ana Salar, Pa?s Vasco, Spain - Cell Surgencia A?ana 2014

Overview

Basic Information
IMG/M Taxon OID	3300007852 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118086 \| Gp0127904 \| Ga0104935
Sample Name	Non-marine hypersaline water microbial communities of A?ana Salar, Pa?s Vasco, Spain - Cell Surgencia A?ana 2014
Sequencing Status	Permanent Draft
Sequencing Center	University of Alicante
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	78816411
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → Viruses → Predicted Viral	1
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Non-Marine Hypersaline Water Microbial Communities Of A??Ana Salar, Pa??S Vasco, Spain
Type	Environmental
Taxonomy	Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline Water → Non-Marine Hypersaline Water Microbial Communities Of A??Ana Salar, Pa??S Vasco, Spain

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Hypersaline (saline)

Location Information
Location	A?ana Salar (Pa?s Vasco, Spain)
Coordinates	Lat. (^o)	42.80111387	Long. (^o)	-2.985507	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003128	Metagenome	506	Y
F066493	Metagenome	126	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0104935_109528	All Organisms → Viruses → Predicted Viral	1541	Open in IMG/M
Ga0104935_148197	Not Available	506	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0104935_109528	Ga0104935_1095282	F003128	MQVEIEVDPEDIVKKKADDRGRVTLGAEYAGKKVRVAVLEVVEE*
Ga0104935_148197	Ga0104935_1481971	F066493	MSQREWHDGVVDVADELVKEHSAEGAIERLQSRRQSSNEQLQQRCTEAIAYIRREVLADE

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.