NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008083

3300008083: Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764447348 reassembly



Overview

Basic Information
IMG/M Taxon OID3300008083 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0063646 | Gp0052902 | Ga0105970
Sample NameHuman supragingival plaque microbial communities from NIH, USA - visit 1, subject 764447348 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size84869181
Sequencing Scaffolds7
Novel Protein Genes8
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga → unclassified Capnocytophaga → Capnocytophaga sp. CM591
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria1
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cardiobacteriales → Cardiobacteriaceae → Cardiobacterium → unclassified Cardiobacterium → Cardiobacterium sp.1
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030786Metagenome184N
F040685Metagenome161N
F049707Metagenome146N
F085821Metagenome111N
F097526Metagenome104Y
F097527Metagenome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0105970_100003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae400940Open in IMG/M
Ga0105970_100638All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes18582Open in IMG/M
Ga0105970_100991All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga → unclassified Capnocytophaga → Capnocytophaga sp. CM5911277Open in IMG/M
Ga0105970_101477All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus7575Open in IMG/M
Ga0105970_102524All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria4486Open in IMG/M
Ga0105970_105010All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Cardiobacteriales → Cardiobacteriaceae → Cardiobacterium → unclassified Cardiobacterium → Cardiobacterium sp.2398Open in IMG/M
Ga0105970_113612All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes878Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0105970_100003Ga0105970_100003107F040685MKKLLFKLFFTLAFASISLHGQEKIQQVEFSSFGGIALYSERYTLNSLKKEFSAKPLMEQNKDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIITKEFGKKGIYE*
Ga0105970_100003Ga0105970_100003108F040685MKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGMALYSRQYTFNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWEAFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDMETWYDLLQIIAEEFEKI*
Ga0105970_100638Ga0105970_10063820F030786MLVVMIVTSSLQLLLKNGSATKGGNATGAKKANKISFADITDGDKSKVVAIKVKYFDDERADKIFENNNNRILNTINSQHISYNSQSAEYSKPQLFLLYQSLKVDC*
Ga0105970_100991Ga0105970_10099112F085821MSNIFEQLAPLAETKKQQTTIAKFIEKGFKFTRQPDAQKFTFLVYDFFVAGNMPAVQLCIDYLVAQGYPTAENKKQFLNWIFMEPVYYLKYFISDASTQKKLHHDLLNLWYESNKRLLLEQDKGKHDEAYIDAWNEANVNKTLSIIRSGETIASCKEDVAKHSRTLNDEYEQNVNLLDEYCRALLYTAETTKSQQELVAETQSHIALLKNLYKKVNKIK*
Ga0105970_101477Ga0105970_10147711F097527MIYFKMEKIGNSTKTEKKKTRSENLVIITIPAAGGEPARPCGHRVLSA
Ga0105970_102524Ga0105970_1025243F097526MTATADNTTTTPIAPYTQDGYRQLCERLDDDTVAALLHAHIRAFAADGNRQRLNRLTEAMRIAGEMEKAGRNEHPDPAEQKRRARWDSNLARLQQQARMAHCEIVNADNAAVSQLTQQCKKNGSRDTAIPLPRDDYGFAAAVRDFPLSETQTALLWRMSLLTIAEIADIAPELAAIYLNGTGGEHMGRALVEKTVYPVTVVSNLARLLHEQHKSGQLQRDLRYITTALGSEVQGKPQ*
Ga0105970_105010Ga0105970_1050106F097526MQHFSAQPDGTAAITPYTQDDYRRLCERLDDDTVAALLHAHIDAFAADGNRQLLKRLTEAMHIAAEFEQAGRNGHPDSEEQTRRAYWDCHFAALQQHARMAGNQITNADNAAVSRLTRQCEKNGSCDTAIPSPHDDDYGFAAALRDIPLNEKQTALLWRMALLTIAEMMDAVPSLVAHYLNGIGGEHLGRALAGKTVYPVTVVSNLAWLLHEQQKSGQLQRDLWHSAAALGSGDAEVREKPQ*
Ga0105970_113612Ga0105970_1136122F049707VVSEYRSPHNDGHDPYILIWEYGNDIRRAEFSERWAEYDETGWTVWYFRLVDGGIMTFSSREWEQKDDVNHLTTIWMRPSLYDIERKAS*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.