NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008305

3300008305: Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159753524 replicate 1 reassembly



Overview

Basic Information
IMG/M Taxon OID3300008305 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0063646 | Gp0053233 | Ga0115183
Sample NameHuman tongue dorsum microbial communities from NIH, USA - visit 1, subject 159753524 replicate 1 reassembly
Sequencing StatusPermanent Draft
Sequencing CenterBaylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size63010513
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameHuman Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationNational Institutes of Health, USA
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067846Metagenome125Y
F073671Metagenome120N
F097527Metagenome104N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0115183_100074All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae41224Open in IMG/M
Ga0115183_108789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Lactobacillales → Streptococcaceae → Streptococcus1452Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0115183_100074Ga0115183_10007413F067846MSIIAEWERQEFNKWDKQCGKEDDYNRAVEMEIEAIKENIANCDDDVICVFREKMLDYDDVINTFDDDTFNDDEFIKAVALGTDYEEMRIKILTAMAEDRLEQLEKDYRNGYILND*
Ga0115183_100074Ga0115183_1000747F073671MEKETEHELAELHEKERSLEKTLELVREKIRELVNYTNKNKGQK*
Ga0115183_108789Ga0115183_1087891F097527MIYFKMEKIGNSTYNKEKKTRSENLVFNTIPAAGVEPARP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.