x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300008307
3300008307: Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765074482 reassembly
Overview
Basic Information
IMG/M Taxon OID 3300008307 Open in IMG/M GOLD Reference Gs0063646 | Gp0053236 | Ga0115186 Sample Name Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 765074482 reassembly Sequencing Status Permanent Draft Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis Published? N Use Policy Open
Dataset Contents
Total Genome Size 32508817 Sequencing Scaffolds 2 Novel Protein Genes 2 Associated Families 2
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga 1 All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctSdk10 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location National Institutes of Health, USA Coordinates Lat. (o ) N/A Long. (o ) N/A Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F027205 Metagenome 195 N F085821 Metagenome 111 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0115186_102142 All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Capnocytophaga 2131 Open in IMG/M Ga0115186_115451 All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Siphoviridae sp. ctSdk10 580 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0115186_102142 Ga0115186_1021422 F085821 MDHIFEQLAPLAETKKQQTTVAKFIEKGFKFTRQPDAQKFTFLVYDFFIAGNMPAVQLCIDYLVAQGYPTAENKKQFLNWIFMEPVYYLKYFISDASTQKKLHHDLLNLWYESSKRQLLEQDKGKHDEAYIDAWNEASVNKTLSIIRSGETIASGKEDVVELAESLNDEYELNISLLDEYCRALLYTAETTQSQQELVAETQSHIALLKDLYKKVNKIK* Ga0115186_115451 Ga0115186_1154511 F027205 VASRLIVSADDILKAVKESEEFEKKALSEARKRDRAEGKEPRETLYPNPDLKPGREIVLDYIKTPERRRTPRCSVHLEKRTANNSYRFIVDVSQVRNRELADEIEKDLFAFMDYLLDEYDIPRRIRK*
