Sample 3300008580

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008580

3300008580: Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-11-61

Overview

Basic Information
IMG/M Taxon OID	3300008580 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117952 \| Gp0126200 \| Ga0103611
Sample Name	Microbial communities from hydrothermal vents in Mid Cayman Rise, Atlantic Ocean - CTD-11-61
Sequencing Status	Permanent Draft
Sequencing Center	University of Michigan
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	5945021
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED161	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vents → Microbial Communities From Hydrothermal Vents In Mid Cayman Rise, Atlantic Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine hydrothermal vent biome → marine hydrothermal vent → hydrothermal fluid
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Subsurface (non-saline)

Location Information
Location	Atlantic Ocean
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067833	Metagenome / Metatranscriptome	125	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0103611_100371	All Organisms → cellular organisms → Bacteria → unclassified Bacteria → bacterium TMED161	579	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103611_100371	Ga0103611_1003711	F067833	LTVLLHHVKTRVYGIVVMDNASLHHMYVMAQVNFVTQAGLQTVLMAQMKA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.