x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy .
OK
Sample 3300008732
3300008732: Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159611913 reassembly
Overview
Basic Information
IMG/M Taxon OID 3300008732 Open in IMG/M GOLD Reference Gs0063646 | Gp0053056 | Ga0113984 Sample Name Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159611913 reassembly Sequencing Status Permanent Draft Sequencing Center Baylor College of Medicine, J. Craig Venter Institute (JCVI), Washington University in St. Louis Published? N Use Policy Open
Dataset Contents
Total Genome Size 71254703 Sequencing Scaffolds 1 Novel Protein Genes 1 Associated Families 1
Dataset Phylogeny
Taxonomy Groups Number of Scaffolds All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae 1
Ecosystem and Geography
Ecosystem Assignment (GOLD)
Name Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase Type Host-Associated Taxonomy Host-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human → Human Microbial Communities From The National Institute Of Health, Usa, Hmp Production Phase
Alternative Ecosystem Assignments
Environment Ontology (ENVO) Unclassified Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
Location Information
Location USA: Maryland: Natonal Institute of Health Coordinates Lat. (o ) 39.0042816 Long. (o ) -77.1012173 Alt. (m) N/A Depth (m) N/A Location on Map
Zoom: - Reset +
Powered by OpenStreetMap ©
Associated Families
Family Category Number of Sequences 3D Structure?
F073671 Metagenome 120 N
Associated Scaffolds
Scaffold Taxonomy Length IMG/M Link Ga0113984_103311 All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pasteurellales → Pasteurellaceae 3414 Open in IMG/M
Sequences
Scaffold ID Protein ID Family Sequence
Ga0113984_103311 Ga0113984_1033117 F073671 MGKEQLERELAGLHEKERSLEKALELVREKIRELVNYTDKNKG*
