NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300008851

3300008851: Microbial communities from dairy cow rumen, for metatranscriptome studies - 6021_control diet



Overview

Basic Information
IMG/M Taxon OID3300008851 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117913 | Gp0125705 | Ga0103379
Sample NameMicrobial communities from dairy cow rumen, for metatranscriptome studies - 6021_control diet
Sequencing StatusPermanent Draft
Sequencing CenterAarhus University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size25938558
Sequencing Scaffolds2
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMicrobial Communities From Dairy Cow Rumen, For Metatranscriptome Studies
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Microbial Communities From Dairy Cow Rumen, For Metatranscriptome Studies

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal proximal gut

Location Information
Location
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F006460Metagenome / Metatranscriptome372N
F008062Metagenome / Metatranscriptome340Y
F078281Metagenome / Metatranscriptome116N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103379_1000807Not Available672Open in IMG/M
Ga0103379_1002118Not Available500Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103379_1000807Ga0103379_10008071F006460MEPKRFRISQDGQEYAMAIKLLGERVKIECVDASVPGAPIYCRTYTVDELANESRFFQMVPRSNEAQIELMNVVMSEKIRLYNRGDYMEVTFFLPNGEDLMVQLPRESLKMPMINQNMGQSVQQSVVYDPVTGQSRIQTSVVPGVKRSLYDEVRQRPGFGVPFVDSYGDEGFFETGLPSKFNPGGSALPSAVAASLGNSGVAGSQIGLTNSGVVLNNSGVVV*
Ga0103379_1001021Ga0103379_10010211F078281LIDSNKITKVTYVNDFVIPCYARWIEISGNKLILTGGEKDYIESLNSTYMFKFRQIGDTDEGFSAKVYHKKDMICKRRAHSLIYFNDYIYAISGVDKLEMIKKCEKYDIFNDEWIEIPELNYNRQNAALAIHNQRYLYAFSGYDGFRNVDTFEKLDFLNEEKGWELLELKSTSKDCEEVDVKKNRMGVISLDFDRMLIFGGERNNKEY
Ga0103379_1002118Ga0103379_10021181F008062GGFRLGEGEVPVDEIYAAVVALFKGMAETDEATCAGVLENQKDKILEIVYAAIDEVKAGADVSTAAQNALIKLMGVDGLVSECNVLAMPAIITKVTSKDGLVDIFQALIDNIDDVYSYGEDIKAAFDEKDYNAAAEAFGHILAIALDFQVNL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.