Sample 3300008882

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008882

3300008882: Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2031

Overview

Basic Information
IMG/M Taxon OID	3300008882 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117986 \| Gp0126489 \| Ga0103900
Sample Name	Microbial communities of surface water sampled in Lagrangian time series from North Pacific Subtropical Gyre - BioLINCS_ESP_2031
Sequencing Status	Permanent Draft
Sequencing Center	Massachusetts Institute of Technology
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	3269108
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Unclassified → Surface Ocean Water → Microbial Communities Of Surface Water Sampled In Lagrangian Time Series From North Pacific Subtropical Gyre

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine biome → marine water body → surface water
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	North Pacific Ocean
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F101219	Metagenome / Metatranscriptome	102	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0103900_100444	Not Available	528	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0103900_100444	Ga0103900_1004441	F101219	SLPLVFATFFFVWKKQALEVTPESFQEERTQPLDDQVVEPVAPSMAKVENTETEVAQLGSHEKPVEKIDNDIRIAPSQAPPVGNSKPRVLEILEDVKIAIKESVIKNAEGNQALDTRISLVETSMKHPLMILEEKGTKFGQTGEEVITANAHVATHFMLQVVPGTNLLALEEKLS

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.