Sample 3300008887

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300008887

3300008887: T5 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times DE NOVO

Overview

Basic Information
IMG/M Taxon OID	3300008887 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0117429 \| Gp0125095 \| Ga0115941
Sample Name	T5 (2) (Live), Syntrophic microbial communities from anoxic layer of the sediment of River Tyne near Scotswood, United Kingdom - benzoate enriched in lab, transferred 6 times DE NOVO
Sequencing Status	Permanent Draft
Sequencing Center	Shell Corporation
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	110544130
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Unclassified → Sediment → Syntrophic Microbial Communities From An Anoxic Layer Of The Sediment Of River Tyne Near Scotswood, United Kingdom

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	freshwater river biome → river → sediment
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Sediment (non-saline)

Location Information
Location	UK (Newcastle upon Tyne)
Coordinates	Lat. (^o)	54.971158	Long. (^o)	-1.703654	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F050029	Metagenome / Metatranscriptome	146	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0115941_1001908	All Organisms → cellular organisms → Bacteria	2359	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0115941_1001908	Ga0115941_10019083	F050029	MIRTRGENMATIVIHWKDKEIPPMELKAAAYKGADNSIIKITSNGKDYWFNWGECWFLETTSTE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.