NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009342

3300009342: Microbial communities of water from the North Atlantic ocean - ACM59



Overview

Basic Information
IMG/M Taxon OID3300009342 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0117984 | Gp0126426 | Ga0103837
Sample NameMicrobial communities of water from the North Atlantic ocean - ACM59
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Georgia
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size42238383
Sequencing Scaffolds10
Novel Protein Genes11
Associated Families9

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria → Proteobacteria1
Not Available4
All Organisms → cellular organisms → Eukaryota1
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata2
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus → Prochlorococcus marinus str. MIT 92011

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysurface water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationNorth Pacific Ocean
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000075Metagenome / Metatranscriptome2622Y
F002883Metagenome / Metatranscriptome523Y
F004175Metagenome / Metatranscriptome449Y
F009309Metagenome / Metatranscriptome319Y
F010827Metagenome / Metatranscriptome298Y
F011139Metagenome / Metatranscriptome294Y
F036277Metagenome / Metatranscriptome170Y
F090441Metatranscriptome108N
F092219Metagenome / Metatranscriptome107N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103837_1000962All Organisms → cellular organisms → Bacteria → Proteobacteria1095Open in IMG/M
Ga0103837_1001254Not Available1012Open in IMG/M
Ga0103837_1001503Not Available959Open in IMG/M
Ga0103837_1003206Not Available764Open in IMG/M
Ga0103837_1003276Not Available758Open in IMG/M
Ga0103837_1004428All Organisms → cellular organisms → Eukaryota691Open in IMG/M
Ga0103837_1006266All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata621Open in IMG/M
Ga0103837_1006863All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Tunicata → Appendicularia → Copelata → Oikopleuridae → Oikopleura → Oikopleura dioica604Open in IMG/M
Ga0103837_1009264All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Urostylida → Pseudourostylidae → Pseudourostyla → Pseudourostyla cristata547Open in IMG/M
Ga0103837_1012019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Synechococcales → Prochlorococcaceae → Prochlorococcus → Prochlorococcus marinus → Prochlorococcus marinus str. MIT 9201501Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103837_1000962Ga0103837_10009622F092219MKKFITALAATFATVVIGSAASAATPTFNVYHEEVLPALVETNAPATFSVYHEEVLPALVAANTPPTFNVVREEILPAMNRAVASMPVTFAEVYGDIVYHEEVVPVADADPFSEHVVGGLGPQLPYDPMRGVDYGFVQALLQQNADPFAEEIVGGLGPQGDIDPFAEEIVGGLGPQINFVASN*
Ga0103837_1001254Ga0103837_10012541F090441LPNHGLFKNLLSNPKILQKGEVWELATLSFLDSLAFGALVTRRAIVGCQFPDAVSYRKNDCDTFRSHSGT*
Ga0103837_1001503Ga0103837_10015031F090441EVWELATLSFPDSLALGALITRRVIVGCQFPDAALNRKNDCDTFRFHSGT*
Ga0103837_1003206Ga0103837_10032063F002883MSTLHHEDMLLQIFDEVCEAFPYLDEEKQIEIANNRFWELAQ*
Ga0103837_1003276Ga0103837_10032761F010827MWVLLWLQVISGSFDHYHVGSYSSEEACKVAQKEAKVLVTNNNSKVVCIKIER*
Ga0103837_1004428Ga0103837_10044281F004175LKNEDANSKLVEVVTVADVDAEDHVGNSLLIWELTFGHKAEL*
Ga0103837_1006266Ga0103837_10062661F011139MGLFLGLIAGLPFVYNIYNPMNRYAATIPMQNSILQTSAFIFFMLSLFCANSMLPCGRYYYEPEGGYVGNP*
Ga0103837_1006863Ga0103837_10068632F009309TRDITDKKWTLQTLNIEILTFKYYLTVGFDLTVTAAVKKLSVVSPGTATSSVTVQSFEWKSVWVSTATSFFSGNSFDTWFDWASFVVAWVESVVVSVGVVVDLRSRQEEGEERVNKLSFDGTSVSGTVVSVQSVARVSQVNSGSGSWVVGDFPWDTRFTGGLGIDDGALVSIS*
Ga0103837_1008687Ga0103837_10086871F000075IILTWHANRYENMNEDDLLVNLESTLSSALSSEARGDADAAVAKTAAIKNIQKALTARILKRLDDGQPLVEVARKMKAIEGMQPQINDMERRLGIMQSVEPVLENAIKTLQKVVDVRGMGKK*
Ga0103837_1009264Ga0103837_10092641F011139MGLFLGSLAFLPVIYNVYNTFNKYVSTIPMQNSILQTTTFTLFMMSLYCANSMLPCGRYYYEPEGGYVGNP*
Ga0103837_1012019Ga0103837_10120191F036277PEPGSNSPLCSNPFVDKSTQYELHSPNKNKIDLSYLGSASLDD*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.