NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009382

3300009382: Microbial communities of water from Amazon river, Brazil - RCM19



Overview

Basic Information
IMG/M Taxon OID3300009382 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0117984 | Gp0126455 | Ga0103866
Sample NameMicrobial communities of water from Amazon river, Brazil - RCM19
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Georgia
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size87225231
Sequencing Scaffolds7
Novel Protein Genes7
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3
All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila1
All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium1
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1
All Organisms → cellular organisms → Eukaryota → Sar1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water → Aquatic Microbial Communities From Amazon River, Brazil And North Atlantic Ocean

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater river biome → river → river water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationAmazon river
CoordinatesLat. (o)N/ALong. (o)N/AAlt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001926Metagenome / Metatranscriptome616Y
F009078Metagenome / Metatranscriptome323Y
F020087Metagenome / Metatranscriptome226N
F020700Metagenome / Metatranscriptome222Y
F022206Metagenome / Metatranscriptome215Y
F038530Metagenome / Metatranscriptome165Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0103866_1012394Not Available785Open in IMG/M
Ga0103866_1012493All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Opitutae → Opitutales → Opitutaceae → Lacunisphaera → Lacunisphaera limnophila782Open in IMG/M
Ga0103866_1012580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium779Open in IMG/M
Ga0103866_1016381Not Available686Open in IMG/M
Ga0103866_1023591All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium578Open in IMG/M
Ga0103866_1027607All Organisms → cellular organisms → Eukaryota → Sar538Open in IMG/M
Ga0103866_1028463Not Available531Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0103866_1012394Ga0103866_10123943F009078HVTKPAHSREGAITDKTGGCNRDAECSGKNVVRRAARNTGQWKVTGGADFTTKPIWLSGMRKGSVFVRRVAPKGSYAVLVVSGAVAKAAGSH*
Ga0103866_1012493Ga0103866_10124931F038530MRPTASHAAVSSVGKHTARESEAPNAVRMEKSAWRAPTSDKKK
Ga0103866_1012580Ga0103866_10125802F020087MYGRPFEILEGDDLQSLCESTIKKGGGALATNTAMMCRPFCASGAGNPIISAHRSPIPGFEWDEVWFGFEDFTSEEEFLRKHGYYGSGRCYIVVRVDGRKKLVALKDFIQHVPDAILGPKLKALGHGMFRYSKFFINKNRLPHHTHDVKEEAYWIEPTMIPDYDLFDEQCFMSIGLHQDFGPAELRKLLTVEGWNNPMNKIKRHA
Ga0103866_1016381Ga0103866_10163811F020700MTARLSLHLRFARLCPKTLQGAFSDAAAGIAATSIRLRIYVLFQAVKPEKV
Ga0103866_1023591Ga0103866_10235911F022206FMQQAEQARAQDLVTAVNLAKRADLFAADLVSRLP*
Ga0103866_1027607Ga0103866_10276071F001926VKHEDIPETNKPKIRNAVLEGDKLMKEVLNGGYNVHPVPPPNSEIKERIRRRYERKRIKIEKLLILGYTTSGDP*
Ga0103866_1028463Ga0103866_10284631F009078MVHVNKPAQAREGPITYKTGGGNRDAECSGKNGDLPARKGNRSHWKVTGGADFTAKPTRLSGMRKGSVLVQGVAPKGWYAV*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.