NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300009555

3300009555: Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 8m; RNA IDBA-UD



Overview

Basic Information
IMG/M Taxon OID3300009555 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0116874 | Gp0146830 | Ga0130031
Sample NameAquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 5, Depth 8m; RNA IDBA-UD
Sequencing StatusPermanent Draft
Sequencing CenterMarine Biological Laboratory
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size12167573
Sequencing Scaffolds5
Novel Protein Genes6
Associated Families6

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum1
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameAquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond → Aquatic Microbial Communities From Different Depth Of Meromictic Siders Pond, Falmouth, Massachusetts

Alternative Ecosystem Assignments
Environment Ontology (ENVO)freshwater biome → meromictic pond → pond water
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Water (non-saline)

Location Information
LocationFalmouth, Massachusetts
CoordinatesLat. (o)41.548517Long. (o)-70.622961Alt. (m)N/ADepth (m)8
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F004260Metagenome / Metatranscriptome446Y
F032675Metagenome / Metatranscriptome179Y
F077986Metagenome / Metatranscriptome117Y
F080037Metagenome / Metatranscriptome115Y
F082628Metagenome / Metatranscriptome113N
F086646Metagenome / Metatranscriptome110Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0130031_100437All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1704Open in IMG/M
Ga0130031_100491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Chlorobi → unclassified Chlorobiota → Chlorobiota bacteirum1561Open in IMG/M
Ga0130031_101492Not Available826Open in IMG/M
Ga0130031_102181Not Available691Open in IMG/M
Ga0130031_104018Not Available537Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0130031_100437Ga0130031_1004372F004260MNIETHLLNHLKADQQKFALEALKRPQERDTFEYGYRVGVVAGYEAAIKVLLTLIDEEKNGNNEL*
Ga0130031_100491Ga0130031_1004913F086646LASYQRKNESGDIIMDFIFSIKNHYFEKGTPWVELDKIKQRCWFLSVDIEDDETVPCYDTGDERYSTGVDYRIDEGIAFKSVQILTSKTQETHPYWESLLDMSYLYSTELRDVTFKDLPSESGIYMLNIWFDHDGEELNFGDDFKKLCEHRHKWDDEWVCSKCGVRKSDWVELDKIR*
Ga0130031_101492Ga0130031_1014921F080037SPVINRLHDCMTQALAYAAAIRDNAQDDGQPIPMDLVISFEDDYNKIIASLHEAHHLAS*
Ga0130031_102181Ga0130031_1021812F082628MGYVVVYDKFLEDSTWLLNARRTFREKKEALTFARDCEHSAYTANVKVYEL*
Ga0130031_102181Ga0130031_1021813F077986EGTLVWIVASVEDDALQVNCDNDEIVVEPHGFRAMPLYADKQWVKPLTEEEIQEYNRNL*
Ga0130031_104018Ga0130031_1040181F032675YVGRECDWTPAASGSTSTGLSATYLSAVQGTSGQFQITGFSHNVNDSLTDAYVIATVRMNEAQYKASVNTIA*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.