Sample 3300009847

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300009847

3300009847: Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - SF2CT

Overview

Basic Information
IMG/M Taxon OID	3300009847 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118233 \| Gp0131530 \| Ga0118745
Sample Name	Wood falls microbial communities from Lacaze-Duthiers Canyon, Mediterranean Sea, France - SF2CT
Sequencing Status	Permanent Draft
Sequencing Center	Molecular Research LP (MR DNA)
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	40238430
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France
Type	Environmental
Taxonomy	Environmental → Aquatic → Marine → Oceanic → Benthic → Wood Falls → Wood Falls Microbial Communities From Lacaze-Duthiers Canyon, Mediterranean Sea, France

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	marine benthic biome → marine benthic feature → wood
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Surface (saline)

Location Information
Location	Lacaze-Duthiers Canyon
Coordinates	Lat. (^o)	42.4666667	Long. (^o)	3.4666667	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011735	Metagenome / Metatranscriptome	287	Y
F057039	Metagenome / Metatranscriptome	136	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0118745_104521	Not Available	939	Open in IMG/M
Ga0118745_111385	Not Available	620	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0118745_104521	Ga0118745_1045211	F057039	VGSKMMVHVLGWEWIFQMDVVGVVIVVEVKGRDNLELSMEDTQENNEDIVDGSHKFLSNLVANIVFEVEMDNVAKGKVCSSYF*
Ga0118745_111385	Ga0118745_1113852	F011735	PYIVKRVLQKGAYELVDYEGNPLDKPRNGLYLKKYYA*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.