 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| IMG/M Taxon OID | 3300009850 Open in IMG/M |
| GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118754 | Gp0148682 | Ga0130085 |
| Sample Name | Sorghum rhizosphere soil microbial communities in Albany, CA (condition:control)- sample C |
| Sequencing Status | Permanent Draft |
| Sequencing Center | QB3 Vincent J. Coates Genomics Sequencing Laboratory |
| Published? | N |
| Use Policy | Open |
| Dataset Contents | |
|---|---|
| Total Genome Size | 52783870 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny | |
|---|---|
| Taxonomy Groups | Number of Scaffolds |
| Not Available | 2 |
| All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Fiersviridae | 1 |
| Ecosystem Assignment (GOLD) | |
|---|---|
| Name | Sorghum Rhizosphere Soil Microbial Communities From California, Usa |
| Type | Host-Associated |
| Taxonomy | Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Sorghum Rhizosphere Soil Microbial Communities From California, Usa |
| Alternative Ecosystem Assignments | |
|---|---|
| Environment Ontology (ENVO) | terrestrial biome → rhizosphere → soil |
| Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere |
| Location Information | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location | California,USA | |||||||
| Coordinates | Lat. (o) | 37.887207 | Long. (o) | -122.304401 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F021903 | Metagenome / Metatranscriptome | 216 | Y |
| F028190 | Metagenome / Metatranscriptome | 192 | Y |
| F065443 | Metagenome / Metatranscriptome | 127 | N |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| Ga0130085_1015825 | Not Available | 500 | Open in IMG/M |
| Ga0130085_1050789 | Not Available | 618 | Open in IMG/M |
| Ga0130085_1099166 | All Organisms → Viruses → Riboviria → Orthornavirae → Lenarviricota → Leviviricetes → Norzivirales → Fiersviridae | 3781 | Open in IMG/M |
| Scaffold ID | Protein ID | Family | Sequence |
|---|---|---|---|
| Ga0130085_1015825 | Ga0130085_10158251 | F065443 | DRLNTYAQASGASLIQVASAAKSHLNNFAAKMKEMSHKLSKHGSMYAPLIHELVQLTQSVDNGDVSQVVDLINQLLNLLNNALADLLAQQAAYESNYQNHVQAANDNLAAYQAQMDFDAGRADEVGSQDVQANAQLDMAEQNLADAQAALENNQSAFDSNEASYAD |
| Ga0130085_1050789 | Ga0130085_10507891 | F021903 | DLHSSNQILPYAKLVTDSAQGYGPEVVDFYGVPGQLALGFSSTYSAGAAANAYEVWVDRPNSSPNTDSAFTFLYDTNSFIVVYQADVGNGNKQILFDDRTKVPYAYGFYNTDQWNKVPTTATLWHILDISLVHQGFVYNGFPGENNTADTSATPGAKYGYDGQFFEKTKSIPCGHVASRGANPAYCPATLTYPQVKK* |
| Ga0130085_1099166 | Ga0130085_10991662 | F028190 | MASITVKKADGTTDIVFDNLAASGGDNSPAVWRQDTGAAAGLPVGLRSLFRVSSKWNGPKTARQVTFEFTQPYAVQDSTTTKYSATDRVVFNGVVTLPQAIPAANLNEVVQVLNLLASTLIKSAVQAGYAPS* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |