NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300010010

3300010010: Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #3 sample B3



Overview

Basic Information
IMG/M Taxon OID3300010010 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0120461 | Gp0151266 | Ga0133901
Sample NameMicrobial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #3 sample B3
Sequencing StatusPermanent Draft
Sequencing CenterUniversity of Maryland
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size41781415
Sequencing Scaffolds3
Novel Protein Genes3
Associated Families3

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
Not Available3

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBlack Band Disease Transitions
TypeHost-Associated
TaxonomyHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal surface

Location Information
LocationBelize: Carrie Bow Cay Field Station
CoordinatesLat. (o)16.80288Long. (o)-88.08213Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F047483Metagenome / Metatranscriptome149Y
F051693Metagenome / Metatranscriptome143N
F085126Metagenome / Metatranscriptome111Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0133901_105645Not Available998Open in IMG/M
Ga0133901_118714Not Available528Open in IMG/M
Ga0133901_119355Not Available518Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0133901_105645Ga0133901_1056451F085126VAIFRPTSSKVSVQKVLLCPFDCKPRQSGVSLESPELENILQVPGNGAEVDENYDARNGLSVILSVLNLSRAILRH*
Ga0133901_118714Ga0133901_1187141F047483MQATVMAVTVDEMFICPKLGQNLSEMEVRTFVRIQKVIWDQLVASKAEFIQK*
Ga0133901_119355Ga0133901_1193551F051693VIKFTDKLPFACVRFIVKYIEENIENFNTRLISRGYPEQMVEKTLREVKYKDRKEALKQKSKIAEGTTTLCVGQFHSTVNTKLWKA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.