Sample 3300010012

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300010012

3300010012: Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #1 sample B1

Overview

Basic Information
IMG/M Taxon OID	3300010012 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0120461 \| Gp0149151 \| Ga0133895
Sample Name	Microbial communities of stony corals with Black-band disease (BBD) from Carrie Bow Cay Field Station, Belize; BBD Transitions coral #1 sample B1
Sequencing Status	Permanent Draft
Sequencing Center	University of Maryland
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	48742759
Sequencing Scaffolds	2
Novel Protein Genes	2
Associated Families	2

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
Not Available	2

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Black Band Disease Transitions
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated → Black Band Disease Transitions

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal surface

Location Information
Location	Belize: Carrie Bow Cay Field Station
Coordinates	Lat. (^o)	16.80288	Long. (^o)	-88.08213	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F017437	Metagenome / Metatranscriptome	240	Y
F082762	Metagenome / Metatranscriptome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0133895_1004765	Not Available	799	Open in IMG/M
Ga0133895_1007707	Not Available	639	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0133895_1004765	Ga0133895_10047651	F082762	SGANITNSTSPLMLTKNITLTVVDCCAPPPVRLAFHCAGVVATIGASIAAPSPITIGSAIHLLSEIYEEC*
Ga0133895_1007707	Ga0133895_10077071	F017437	MGRKLLFVVPLTNAQLHLTKRKMSSNGSANVKHSEAMSDEIVTAMSTACGASIFLFELFKKNLESICCPSYEMNAGSWQAWVLIT*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.