x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our
privacy policy.
OK
Sample 3300010228
3300010228: Freshwater aquifer microbial community from Bangor, North Wales, UK, enriched with nitrile substrate, replicate 2
Overview
| Basic Information |
| IMG/M Taxon OID | 3300010228 Open in IMG/M |
GOLD Reference
(Study | Sequencing Project | Analysis Project) | Gs0121426 | Gp0154199 | Ga0136269 |
| Sample Name | Freshwater aquifer microbial community from Bangor, North Wales, UK, enriched with nitrile substrate, replicate 2 |
| Sequencing Status | Permanent Draft |
| Sequencing Center | Fidelity Systems Inc |
| Published? | N |
| Use Policy | Open |
| Dataset Contents |
| Total Genome Size | 104504819 |
| Sequencing Scaffolds | 3 |
| Novel Protein Genes | 3 |
| Associated Families | 3 |
| Dataset Phylogeny |
| Taxonomy Groups | Number of Scaffolds |
|---|
| All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM1 | 1 |
| Not Available | 1 |
| All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 1 |
Ecosystem and Geography
| Ecosystem Assignment (GOLD) |
| Name | Freshwater Microbial Communities Enriched With Nitrile Substrates |
| Type | Engineered |
| Taxonomy | Engineered → Lab Enrichment → Unclassified → Unclassified → Unclassified → Freshwater → Freshwater Microbial Communities Enriched With Nitrile Substrates |
| Alternative Ecosystem Assignments |
| Environment Ontology (ENVO) | Unclassified |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Water (non-saline) |
| Location Information |
| Location | Bangor, North Wales, UK |
| Coordinates | Lat. (o) | 53.23 | Long. (o) | -4.13 | Alt. (m) | N/A | Depth (m) | N/A |
Location on Map |
|
|
| Zoom: |
Powered by OpenStreetMap © |
Associated Families
| Family | Category | Number of Sequences | 3D Structure? |
|---|
| F036294 | Metagenome / Metatranscriptome | 170 | Y |
| F064731 | Metagenome | 128 | Y |
| F096595 | Metagenome | 104 | Y |
Associated Scaffolds
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|
| Ga0136269_1004125 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Thermoanaerobaculia → Thermoanaerobaculales → Candidatus Sulfomarinibacteraceae → Candidatus Sulfomarinibacter → unclassified Candidatus Sulfomarinibacter → Candidatus Sulfomarinibacter sp. MAG AM1 | 1778 | Open in IMG/M |
| Ga0136269_1011031 | Not Available | 962 | Open in IMG/M |
| Ga0136269_1015157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfobacterales | 836 | Open in IMG/M |
Sequences
| Scaffold ID | Protein ID | Family | Sequence |
|---|
| Ga0136269_1004125 | Ga0136269_10041251 | F064731 | MSSFRRVALFLSILAFVAPFSPAADFEADTNGPWINVDVIDLADYGDATYLDYLGEGYVAMLDALMSEEMILDYGVMMKTTGSTSDGDVVVWWSVKSLADYEKALERMGTLAGELWTEGELAELWPKLEKVRTIKSSNLXXXXLYRAVLWNKVAE* |
| Ga0136269_1011031 | Ga0136269_10110311 | F096595 | MDSIIKFGQYVKHIRTKKGMTQFQLSQKVFDKPNYEYIGKLERGELEGITFGTVDKILTALDSEMGFSQFETYVADSYQ* |
| Ga0136269_1015157 | Ga0136269_10151572 | F036294 | VVVTDRGSADEAVVGVKPIAVEDVVTPLRVKLSESDKDVGAEGRNM* |
