Basic Information | |
---|---|
IMG/M Taxon OID | 3300010947 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0120447 | Gp0151146 | Ga0138905 |
Sample Name | Termite gut microbial communities - laboratory nests. Combined Assembly of Gp0151227, Gp0151152, Gp0151149, Gp0151146 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Luxembourg, Luxembourg Institute of Science and Technology |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 221304184 |
Sequencing Scaffolds | 9 |
Novel Protein Genes | 9 |
Associated Families | 9 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Eukaryota → Opisthokonta | 1 |
Not Available | 7 |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Multi-Omic Termite Study |
Type | Host-Associated |
Taxonomy | Host-Associated → Insecta → Digestive System → Unclassified → Unclassified → Termite Gut → Multi-Omic Termite Study |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Unclassified |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | France | |||||||
Coordinates | Lat. (o) | 48.913957 | Long. (o) | 2.485499 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F000394 | Metagenome | 1186 | Y |
F001002 | Metagenome | 809 | Y |
F003069 | Metagenome | 509 | Y |
F006796 | Metagenome | 364 | Y |
F008365 | Metagenome | 334 | Y |
F011413 | Metagenome | 291 | Y |
F014340 | Metagenome | 264 | Y |
F050745 | Metagenome | 145 | Y |
F075418 | Metagenome | 119 | Y |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0138905_1094487 | All Organisms → cellular organisms → Eukaryota → Opisthokonta | 538 | Open in IMG/M |
Ga0138905_1214773 | Not Available | 2257 | Open in IMG/M |
Ga0138905_1287668 | Not Available | 764 | Open in IMG/M |
Ga0138905_1339150 | Not Available | 1251 | Open in IMG/M |
Ga0138905_1351502 | Not Available | 864 | Open in IMG/M |
Ga0138905_1352772 | Not Available | 510 | Open in IMG/M |
Ga0138905_1361879 | Not Available | 509 | Open in IMG/M |
Ga0138905_1533091 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blaberoidea → Ectobiidae → Blattellinae → Blattella → Blattella germanica | 557 | Open in IMG/M |
Ga0138905_1566507 | Not Available | 504 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0138905_1094487 | Ga0138905_10944871 | F003069 | NNWSQWNSSEKLKEKFGSGTRKTFDRFTTKDSYTWNIIHNTQSTAV* |
Ga0138905_1214773 | Ga0138905_12147731 | F075418 | VHRNIITNYSQQDAAFLNLFIFTDSLHVSGGSSTHHQEFHLIHGS |
Ga0138905_1287668 | Ga0138905_12876682 | F008365 | MDPLITEAIELEMYPYNMKRDDGLNMGKSWKPLLHLLKERRQPPGTQ* |
Ga0138905_1339150 | Ga0138905_13391502 | F050745 | MFFKRLVLGKGGVDDVRREPADSSDNAVSVAMAHWNVEHRVFAVEQFFLETVIL* |
Ga0138905_1351502 | Ga0138905_13515021 | F014340 | QQDAATSQVYYNRPDHDQQHCYHHAPTVNPEAATAFVVAPDDGHEDARNMLSCI* |
Ga0138905_1352772 | Ga0138905_13527721 | F000394 | MLYIYIYMERPLLMFPDHTQRRSTVGRTPPDERPARRRD |
Ga0138905_1361879 | Ga0138905_13618791 | F006796 | SLRGSMGTGTKRDESSIGRVWAARFYHVTARSRLARVLKLMNRLFL* |
Ga0138905_1533091 | Ga0138905_15330911 | F011413 | MNKCVPLTKRSQGRPKYGWEDNITQDICQMKIKNWIACVQDQGKWKEVVEKAKTFR* |
Ga0138905_1566507 | Ga0138905_15665072 | F001002 | CLKVNNLTLILLTKENGELLIMPANRRWDLIRALKG* |
⦗Top⦘ |