NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011275

3300011275: Metatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2919 (Metagenome Metatranscriptome) (version 2)



Overview

Basic Information
IMG/M Taxon OID3300011275 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0053074 | Gp0092432 | Ga0138354
Sample NameMetatranscriptome of deep ocean microbial communities from Atlantic Ocean - MP2919 (Metagenome Metatranscriptome) (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size10363070
Sequencing Scaffolds1
Novel Protein Genes2
Associated Families2

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Pelagomonas → Pelagomonas calceolata1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameDeep Ocean Microbial Communities From The Global Malaspina Expedition
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean → Deep Ocean Microbial Communities From The Global Malaspina Expedition

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biome → marine water body → sea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationWest of Santa Cruz de la Palma, Atlantic Ocean
CoordinatesLat. (o)29.97Long. (o)-23.69Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000048Metagenome / Metatranscriptome3365Y
F018182Metagenome / Metatranscriptome236N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0138354_100688All Organisms → cellular organisms → Eukaryota → Sar → Stramenopiles → Ochrophyta → Pelagophyceae → Pelagomonadales → Pelagomonas → Pelagomonas calceolata557Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0138354_100688Ga0138354_1006881F018182MTSNISMKDTRDGVVVKADGRTLLAKLVFAGSARLAECDLGIEELRAAFKKAHGEEASKGTLTYQLNENDEDALQLLDDADLALAKKHGSEPLKITSTEVDSRNVFDHASSELAKHGLDAPPTELKKLLDVLQFKPRRLVKCGLAPPKALKNTLKGDEAEE
Ga0138354_107180Ga0138354_1071801F000048KEFTPWLVGAEKATGEGLAKPASLDEVKALNDKVLAFDKSCVNYLKVLQAADAAAKKMTTHAEADNEVKALLERFNKVKAVSDDWVKKVDVLVKEWVLLDNTVTELNSWVAKDKSSEGENQFSLEKMESTLGELKNIFKEKEKLVDGL*
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.