NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300011280

3300011280: Seawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 NT37 metaT (Metagenome Metatranscriptome) (version 2)



Overview

Basic Information
IMG/M Taxon OID3300011280 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0114292 | Gp0127487 | Ga0138372
Sample NameSeawater microbial communities from Saanich Inlet, British Columbia, Canada - KN S23 NT37 metaT (Metagenome Metatranscriptome) (version 2)
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size17410433
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Eukaryota2
All Organisms → Viruses → Predicted Viral1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameMarine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling
TypeEnvironmental
TaxonomyEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From The Southern Atlantic Ocean Transect To Study Dissolved Organic Matter And Carbon Cycling

Alternative Ecosystem Assignments
Environment Ontology (ENVO)marine biomemarine water bodysea water
Earth Microbiome Project Ontology (EMPO)Free-living → Saline → Water (saline)

Location Information
LocationSouthern Atlantic ocean
CoordinatesLat. (o)-28.2362Long. (o)-38.4949Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009310Metatranscriptome319N
F021307Metagenome / Metatranscriptome219Y
F029011Metatranscriptome189Y
F064419Metatranscriptome128N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0138372_107258All Organisms → cellular organisms → Eukaryota548Open in IMG/M
Ga0138372_120032All Organisms → Viruses → Predicted Viral1098Open in IMG/M
Ga0138372_122769All Organisms → cellular organisms → Eukaryota543Open in IMG/M
Ga0138372_137643All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1191Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0138372_107258Ga0138372_1072581F064419TKKFEFNGKEVATVDFDSSSKKASHTMHLPSGKDLTIDLAWPKMTPAASDLEFGITITPDRKVVTKFGWEMAGVKKVYLDVVGNNPWMGDYKLSRQGEFEEVSGSVYKIKWTGHGETTKGFLRRVSPVETNVVASVNVRNMKVDAIVWKSFAGQKYGFTLTNDKFTLLAGKH*
Ga0138372_120032Ga0138372_1200321F009310YKFIQKFMFLADRPQEGSFVLYRKMEGGMWKTKVTVDNNNMMPKPFLDISVESDRKTKLHVLFNFQEDNKWELKVDRVPGQKMTIEATVNGKKWTGVGNLNQGEMKLNLKIDSEFTGKHYTLDFDLNPSGMWGIHITGDVDGPVDAKWTMQKDYTMGEIVVKYKNQNYAFMQLKGNAEMRGVFPVVFDYVVKYNIKDAMEHQGKAKMKFDGKTPAKKFEMSFAPKTGTPMDLIWNMDFSSGFKYDYDFKMNAVTMEKGNGEYKWVNNGQKFELMTKDTFIVTKQSPFHWMNTMVTGGREWTKMEHTRNIFFDKVNKAQMINKMKIEEHNILDGQTWYHIKYDNTAPKTAFLFTYLPYNMDQAWTY
Ga0138372_122769Ga0138372_1227691F029011VSTTGFGFLTFDWVAPPVSDTSVKSDFLHSFDIFSKFVIQVVTGHLAVFAVFPVSLSVQEPSWDFEVLWVSHNSLDLFHFGFGQLTGSFGSVDFGFFQDQVGESSTHASDGSQSVGDLDVTVDVGVLHSQNVLKIFRVDKGHDRCFFFSF*
Ga0138372_137643Ga0138372_1376433F021307MNQILYENRCKCNEEISIIRKRKLTTRSEGKPFQYPKPNEILSKTFQIKYEKKLSSTARVILNSFHNKYIYYAIDDILYLLKSNKRER

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.