Sample 3300011722

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300011722

3300011722: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway plastic -P00359

Overview

Basic Information
IMG/M Taxon OID	3300011722 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118444 \| Gp0135964 \| Ga0122010
Sample Name	Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway plastic -P00359
Sequencing Status	Permanent Draft
Sequencing Center	Weill Cornell Medical College
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	32474956
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
Type	Engineered
Taxonomy	Engineered → Built Environment → City → Subway → Unclassified → City Subway Plastic → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	USA:New York City
Coordinates	Lat. (^o)	40.55	Long. (^o)	-74.13	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028713	Metagenome / Metatranscriptome	190	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0122010_112685	All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Acrogymnospermae → Pinopsida → Pinidae → Conifers I → Pinales → Pinaceae → Picea → Picea glauca	568	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0122010_112685	Ga0122010_1126851	F028713	MIEEKKVLLVKVDTLKNIADALTKSVSSKKFSWCRETMCIAGLDK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.