Sample 3300011948

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300011948

3300011948: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00384

Overview

Basic Information
IMG/M Taxon OID	3300011948 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118444 \| Gp0135084 \| Ga0120849
Sample Name	Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00384
Sequencing Status	Permanent Draft
Sequencing Center	Weill Cornell Medical College
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	579601
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)
Type	Environmental
Taxonomy	Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	USA: New York City
Coordinates	Lat. (^o)	43.3	Long. (^o)	-73.97	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081964	Metagenome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120849_100584	Ga0120849_1005847	F081964	MSMAKTHYRHLIVRAVTGNRPAMVWRVIDGAALDRICERLVEAERAAEILQAKGYGKPGLLLNEVAALVPPAP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.