Sample 3300011951

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300011951

3300011951: Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00620

Overview

Basic Information
IMG/M Taxon OID	3300011951 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118444 \| Gp0135212 \| Ga0120977
Sample Name	Urban prokaryotic and eukaryotic communities from the subway in New York, USA: city subway metal -P00620
Sequencing Status	Permanent Draft
Sequencing Center	Weill Cornell Medical College
Published?	Y
Use Policy	Open

Dataset Contents
Total Genome Size	37883904
Sequencing Scaffolds	0
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa
Type	Engineered
Taxonomy	Engineered → Built Environment → City → Subway → Unclassified → City Subway Wood → Urban Prokaryotic And Eukaryotic Communities From The Subway And Surrounding Areas In New York, Usa

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Free-living → Saline → Water (saline)

Location Information
Location	USA: New York City
Coordinates	Lat. (^o)	40.84	Long. (^o)	-73.91	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F081964	Metagenome	113	Y

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0120977_103897	Ga0120977_1038973	F081964	MSMAKDHYRHLIVRAVTGNRPAMVWRVIDAAALDRICERLVEAERAAEILQAKGYGKPGLLLHEVAALVPPAP*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.