NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300013383

3300013383: Baboon gut microbial communities from fecal samples in Kenya - F07



Overview

Basic Information
IMG/M Taxon OID3300013383 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)
Gs0118445 | Gp0134416 | Ga0116616
Sample NameBaboon gut microbial communities from fecal samples in Kenya - F07
Sequencing StatusPermanent Draft
Sequencing CenterDuke University
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size119044757
Sequencing Scaffolds4
Novel Protein Genes4
Associated Families4

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales1
All Organisms → Viruses1
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes1
Not Available1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameBaboon Gut Microbial Communities From Fecal Samples In Kenya
TypeHost-Associated
TaxonomyHost-Associated → Mammals → Digestive System → Large Intestine → Fecal → Baboon Gut → Baboon Gut Microbial Communities From Fecal Samples In Kenya

Alternative Ecosystem Assignments
Environment Ontology (ENVO)Unclassified
Earth Microbiome Project Ontology (EMPO)Host-associated → Animal → Animal distal gut

Location Information
Location
CoordinatesLat. (o)2.717Long. (o)37.1Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F036964Metagenome / Metatranscriptome169Y
F042737Metagenome / Metatranscriptome157Y
F053097Metagenome / Metatranscriptome141Y
F074899Metagenome / Metatranscriptome119N

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
Ga0116616_1000033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales121436Open in IMG/M
Ga0116616_1000051All Organisms → Viruses99844Open in IMG/M
Ga0116616_1002026All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes4459Open in IMG/M
Ga0116616_1044622Not Available523Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
Ga0116616_1000033Ga0116616_100003360F042737MVLTSKSSEVFEYLKNNGGKVSIEELANATGRSARSVGANVLDLTKKGLVVREKEEVEGAEKPVAYAVLTDAGKNFVPSEDAE*
Ga0116616_1000051Ga0116616_100005133F053097MFDIQGSKIILKTDDLAIPPFRDFYNNAKNKQDAIKKIEFIIWRYKWNTPYEAYPEKERTWRVAKDVFNNKDYIPDA*
Ga0116616_1002026Ga0116616_10020262F074899MRGWKQWSKQAVTSSFLDKKLPKSLVQQGLEGATAVGKDEVGSSNLPSSSTKSL*
Ga0116616_1044622Ga0116616_10446222F036964MEPLKIIFPLLMVAGALGSLVVNIVSKGDWATSLQWLGACLLYTALTVRNMS*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.