Basic Information | |
---|---|
IMG/M Taxon OID | 3300013726 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118644 | Gp0137861 | Ga0117822 |
Sample Name | Lung microbial and viral communities from cystic fibrosis patients in San Diego, USA - CF1-1-St-MgMD-nonhuman |
Sequencing Status | Permanent Draft |
Sequencing Center | San Diego State University |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 25513887 |
Sequencing Scaffolds | 1 |
Novel Protein Genes | 1 |
Associated Families | 1 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
Not Available | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Lung Microbial And Viral Communities From Cystic Fibrosis Patients In San Diego, Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Human → Respiratory System → Sputum → Unclassified → Human Lung → Lung Microbial And Viral Communities From Cystic Fibrosis Patients In San Diego, Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal corpus |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: San Diego | |||||||
Coordinates | Lat. (o) | N/A | Long. (o) | N/A | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F054109 | Metagenome | 140 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0117822_106481 | Not Available | 867 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0117822_106481 | Ga0117822_1064812 | F054109 | MVGRPKSKKGTKVHTAFKIYPVDKERAQAMADKLDMSLSAYINKAVLEKVERDEKSEN* |
⦗Top⦘ |