Basic Information | |
---|---|
IMG/M Taxon OID | 3300013830 Open in IMG/M |
GOLD Reference (Study | Sequencing Project | Analysis Project) | Gs0118654 | Gp0138582 | Ga0120377 |
Sample Name | Sheep rumen microbial communities from Wyoming, USA - O_aries_Con_1239 |
Sequencing Status | Permanent Draft |
Sequencing Center | University of Missouri |
Published? | N |
Use Policy | Open |
Dataset Contents | |
---|---|
Total Genome Size | 181596033 |
Sequencing Scaffolds | 4 |
Novel Protein Genes | 4 |
Associated Families | 4 |
Dataset Phylogeny | |
---|---|
Taxonomy Groups | Number of Scaffolds |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 1 |
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1 |
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 1 |
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78 | 1 |
Ecosystem Assignment (GOLD) | |
---|---|
Name | Ruminant Gut Microbial Communities From Various Locations In Usa |
Type | Host-Associated |
Taxonomy | Host-Associated → Mammals → Digestive System → Foregut → Rumen → Sheep Rumen → Ruminant Gut Microbial Communities From Various Locations In Usa |
Alternative Ecosystem Assignments | |
---|---|
Environment Ontology (ENVO) | Unclassified |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Animal → Animal proximal gut |
Location Information | ||||||||
---|---|---|---|---|---|---|---|---|
Location | USA: Wyoming | |||||||
Coordinates | Lat. (o) | 41.314168 | Long. (o) | -105.584589 | Alt. (m) | N/A | Depth (m) | N/A | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F035626 | Metagenome / Metatranscriptome | 171 | Y |
F067315 | Metagenome / Metatranscriptome | 125 | Y |
F082826 | Metagenome / Metatranscriptome | 113 | Y |
F097402 | Metagenome / Metatranscriptome | 104 | N |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
Ga0120377_1002831 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales | 10159 | Open in IMG/M |
Ga0120377_1016792 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales | 1561 | Open in IMG/M |
Ga0120377_1031178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Faecalibacterium → Faecalibacterium prausnitzii | 844 | Open in IMG/M |
Ga0120377_1038388 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Dikarya → Basidiomycota → Pucciniomycotina → Pucciniomycetes → Pucciniales → Pucciniaceae → Puccinia → Puccinia striiformis → Puccinia striiformis f. sp. tritici → Puccinia striiformis f. sp. tritici PST-78 | 691 | Open in IMG/M |
Scaffold ID | Protein ID | Family | Sequence |
---|---|---|---|
Ga0120377_1002831 | Ga0120377_100283116 | F067315 | MNKLEDFSNWLQIFSFLILIEDFNNTDLMKYLAHQDDLLNKIIDQNNELITLLKGGK* |
Ga0120377_1016792 | Ga0120377_10167921 | F082826 | MANKYTIEFNYNASIVVDVEGEFHDEGEALDKAREIAEDADINEFTIGEERESKILNVR |
Ga0120377_1031178 | Ga0120377_10311782 | F097402 | MTNLDHIQSLIHHGAQLRGEDGSLTPLTKAFYHNAVEACHTGGYNAATYDLVLPGIDSELWLAIWKDGHADSGSPKSICACLAR* |
Ga0120377_1038388 | Ga0120377_10383881 | F035626 | MAPLIINNDAVQGETFLPGQIFVFGGFALRANSLGHLEQIESYAPGHQVRFGSLNYTADIRGDLIFDRFEPQPSAPHCHDGHDLALLLDSALEAAPASASTLNSEPTAPIEDGRLDATSGAAIQTAIEPNTNPVLCEA |
⦗Top⦘ |