Sample 3300013903

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Sample 3300013903

3300013903: Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 244

Overview

Basic Information
IMG/M Taxon OID	3300013903 Open in IMG/M
GOLD Reference (Study \| Sequencing Project \| Analysis Project)	Gs0118643 \| Gp0137841 \| Ga0117802
Sample Name	Human gut microbial communities from patients with symptomatic atherosclerosis - Chalmers University of Technology - 244
Sequencing Status	Permanent Draft
Sequencing Center	Chalmers University of Technology
Published?	N
Use Policy	Open

Dataset Contents
Total Genome Size	78210925
Sequencing Scaffolds	1
Novel Protein Genes	1
Associated Families	1

Dataset Phylogeny
Taxonomy Groups	Number of Scaffolds
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
Name	Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology
Type	Host-Associated
Taxonomy	Host-Associated → Human → Digestive System → Unclassified → Unclassified → Human Gut → Human Gut Microbial Communities From Patients With Symptomatic Atherosclerosis - Chalmers University Of Technology

Alternative Ecosystem Assignments
Environment Ontology (ENVO)	Unclassified
Earth Microbiome Project Ontology (EMPO)	Host-associated → Animal → Animal distal gut

Location Information
Location
Coordinates	Lat. (^o)	N/A	Long. (^o)	N/A	Alt. (m)	N/A	Depth (m)	N/A
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067844	Metagenome	125	N

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
Ga0117802_1001755	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	3213	Open in IMG/M

Sequences

Scaffold ID	Protein ID	Family	Sequence
Ga0117802_1001755	Ga0117802_10017551	F067844	MNTLAAETTSAWYLILNRKLQTLPIYITQLSSHLPRPLTMGTQQVSAGAARIN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.